KEGG   Saccharomyces cerevisiae (budding yeast): YLR350WHelp
Entry
YLR350W           CDS       T00005                                 

Gene name
ORM2
Definition
(RefSeq) sphingolipid homeostasis protein ORM2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ORMDL DUF4271
Motif
Other DBs
NCBI-GeneID: 851064
NCBI-ProteinID: NP_013454
SGD: S000004342
UniProt: Q06144
Position
XII:828730..829380
Genome map
AA seq 216 aa AA seqDB search
MIDRTKNESPAFEESPLTPNVSNLKPFPSQSNKISTPVTDHRRRRSSSVISHVEQETFED
ENDQQMLPNMNATWVDQRGAWLIHIVVIVLLRLFYSLFGSTPKWTWTLTNMTYIIGFYIM
FHLVKGTPFDFNGGAYDNLTMWEQINDETLYTPTRKFLLIVPIVLFLISNQYYRNDMTLF
LSNLAVTVLIGVVPKLGITHRLRISIPGITGRAQIS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgattgaccgcactaaaaacgaatctccagcttttgaagagtctccgcttacccccaat
gtgtctaacctgaaaccattcccttctcaaagcaacaaaatatccactccagtgaccgac
cataggagaagacggtcatccagcgtaatatcacatgtggaacaggaaaccttcgaagac
gaaaatgaccagcagatgcttcccaacatgaacgctacgtgggtcgaccagcgaggcgcg
tggttgattcatatcgtcgtaatagtactcttgaggctcttctactccttgttcgggtcg
acgcccaaatggacgtggactttaacaaacatgacctacatcatcggattctatatcatg
ttccaccttgtcaaaggtacgcccttcgactttaacggtggtgcgtacgacaacctgacc
atgtgggagcagattaacgatgagactttgtacacacccactagaaaatttctgctgatt
gtacccattgtgttgttcctgattagcaaccagtactaccgcaacgacatgacactattc
ctctccaacctcgccgtgacggtgcttattggtgtcgttcctaagctgggaattacgcat
agactaagaatatccatccctggtattacgggccgtgctcaaattagttag

DBGET integrated database retrieval system