KEGG   Saccharomyces cerevisiae (budding yeast): YLR351CHelp
Entry
YLR351C           CDS       T00005                                 

Gene name
NIT3
Definition
(RefSeq) putative hydrolase
  KO
K13566  omega-amidase [EC:3.5.1.3]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00250  Alanine, aspartate and glutamate metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YLR351C (NIT3)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.3  omega-amidase
     YLR351C (NIT3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase DUF1415
Motif
Other DBs
NCBI-GeneID: 851065
NCBI-ProteinID: NP_013455
SGD: S000004343
UniProt: P49954
Structure
PDB: 

Position
XII:complement(829489..830364)
Genome map
AA seq 291 aa AA seqDB search
MSASKILSQKIKVALVQLSGSSPDKMANLQRAATFIERAMKEQPDTKLVVLPECFNSPYS
TDQFRKYSEVINPKEPSTSVQFLSNLANKFKIILVGGTIPELDPKTDKIYNTSIIFNEDG
KLIDKHRKVHLFDVDIPNGISFHESETLSPGEKSTTIDTKYGKFGVGICYDMRFPELAML
SARKGAFAMIYPSAFNTVTGPLHWHLLARSRAVDNQVYVMLCSPARNLQSSYHAYGHSIV
VDPRGKIVAEAGEGEEIIYAELDPEVIESFRQAVPLTKQRRFDVYSDVNAH
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcttcgaagattctttcacaaaaaattaaagttgcgttggtccaactgtcaggc
tcgagtcctgacaaaatggccaatcttcaaagggctgcaacgttcattgaaagggctatg
aaggaacagccggataccaagttggtcgtattgccagaatgcttcaattctccgtactcc
actgatcagtttagaaagtattcagaagttatcaatccgaaagagccttcgacgtcagtt
caatttctgtctaatttagccaataagtttaaaatcatcttggtaggaggaacaattccg
gaattggatccaaagacagacaaaatctacaacacctctataattttcaacgaggatggc
aagttgattgacaagcatcggaaggtccatcttttcgatgtagacattcctaacggtata
tcgttccatgaaagtgaaaccttgagccctggagagaagtctactaccattgacacgaaa
tatggtaagtttggcgtaggtatatgctatgacatgaggtttccggaactcgcaatgcta
agtgcacgcaagggtgcgtttgccatgatctaccctagtgcattcaacactgtcacaggg
cccttgcattggcatttactggcaagaagcagggcagttgacaaccaagtgtacgtgatg
ttatgttctcccgcaaggaatctacagagttcttaccatgcatatggccactctatagtg
gtggaccctagaggcaagattgtagctgaagctggcgagggagaagagattatttatgct
gaattagatcccgaagtcattgagtcatttagacaagcggtacccttaaccaaacaaaga
agatttgacgtgtactccgatgtaaatgcgcattag

DBGET integrated database retrieval system