KEGG   Saccharomyces cerevisiae (budding yeast): YLR354CHelp
Entry
YLR354C           CDS       T00005                                 

Gene name
TAL1
Definition
(RefSeq) sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosphate transaldolase TAL1
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00030  Pentose phosphate pathway
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
sce01230  Biosynthesis of amino acids
Module
sce_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sce_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YLR354C (TAL1)
Enzymes [BR:sce01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     YLR354C (TAL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAL_FSA YajC
Motif
Other DBs
NCBI-GeneID: 851068
NCBI-ProteinID: NP_013458
SGD: S000004346
UniProt: P15019
Position
XII:complement(836350..837357)
Genome map
AA seq 335 aa AA seqDB search
MSEPAQKKQKVANNSLEQLKASGTVVVADTGDFGSIAKFQPQDSTTNPSLILAAAKQPTY
AKLIDVAVEYGKKHGKTTEEQVENAVDRLLVEFGKEILKIVPGRVSTEVDARLSFDTQAT
IEKARHIIKLFEQEGVSKERVLIKIASTWEGIQAAKELEEKDGIHCNLTLLFSFVQAVAC
AEAQVTLISPFVGRILDWYKSSTGKDYKGEADPGVISVKKIYNYYKKYGYKTIVMGASFR
STDEIKNLAGVDYLTISPALLDKLMNSTEPFPRVLDPVSAKKEAGDKISYISDESKFRFD
LNEDAMATEKLSEGIRKFSADIVTLFDLIEKKVTA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaccagctcaaaagaaacaaaaggttgctaacaactctctagaacaattgaaa
gcctccggcactgtcgttgttgccgacactggtgatttcggctctattgccaagtttcaa
cctcaagactccacaactaacccatcattgatcttggctgctgccaagcaaccaacttac
gccaagttgatcgatgttgccgtggaatacggtaagaagcatggtaagaccaccgaagaa
caagtcgaaaatgctgtggacagattgttagtcgaattcggtaaggagatcttaaagatt
gttccaggcagagtctccaccgaagttgatgctagattgtcttttgacactcaagctacc
attgaaaaggctagacatatcattaaattgtttgaacaagaaggtgtctccaaggaaaga
gtccttattaaaattgcttccacttgggaaggtattcaagctgccaaagaattggaagaa
aaggacggtatccactgtaatttgactctattattctccttcgttcaagcagttgcctgt
gccgaggcccaagttactttgatttccccatttgttggtagaattctagactggtacaaa
tccagcactggtaaagattacaagggtgaagccgacccaggtgttatttccgtcaagaaa
atctacaactactacaagaagtacggttacaagactattgttatgggtgcttctttcaga
agcactgacgaaatcaaaaacttggctggtgttgactatctaacaatttctccagcttta
ttggacaagttgatgaacagtactgaacctttcccaagagttttggaccctgtctccgct
aagaaggaagccggcgacaagatttcttacatcagcgacgaatctaaattcagattcgac
ttgaatgaagacgctatggccactgaaaaattgtccgaaggtatcagaaaattctctgcc
gatattgttactctattcgacttgattgaaaagaaagttaccgcttaa

DBGET integrated database retrieval system