KEGG   Saccharomyces cerevisiae (budding yeast): YLR355CHelp
Entry
YLR355C           CDS       T00005                                 

Gene name
ILV5
Definition
(RefSeq) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00290  Valine, leucine and isoleucine biosynthesis
sce00770  Pantothenate and CoA biosynthesis
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01210  2-Oxocarboxylic acid metabolism
sce01230  Biosynthesis of amino acids
Module
sce_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
sce_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    YLR355C (ILV5)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    YLR355C (ILV5)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     YLR355C (ILV5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IlvN IlvC
Motif
Other DBs
NCBI-GeneID: 851069
NCBI-ProteinID: NP_013459
SGD: S000004347
UniProt: P06168
Position
XII:complement(838066..839253)
Genome map
AA seq 395 aa AA seqDB search
MLRTQAARLICNSRVITAKRTFALATRAAAYSRPAARFVKPMITTRGLKQINFGGTVETV
YERADWPREKLLDYFKNDTFALIGYGSQGYGQGLNLRDNGLNVIIGVRKDGASWKAAIED
GWVPGKNLFTVEDAIKRGSYVMNLLSDAAQSETWPAIKPLLTKGKTLYFSHGFSPVFKDL
THVEPPKDLDVILVAPKGSGRTVRSLFKEGRGINSSYAVWNDVTGKAHEKAQALAVAIGS
GYVYQTTFEREVNSDLYGERGCLMGGIHGMFLAQYDVLRENGHSPSEAFNETVEEATQSL
YPLIGKYGMDYMYDACSTTARRGALDWYPIFKNALKPVFQDLYESTKNGTETKRSLEFNS
QPDYREKLEKELDTIRNMEIWKVGKEVRKLRPENQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgttgagaactcaagccgccagattgatctgcaactcccgtgtcatcactgctaagaga
acctttgctttggccacccgtgctgctgcttacagcagaccagctgcccgtttcgttaag
ccaatgatcactacccgtggtttgaagcaaatcaacttcggtggtactgttgaaaccgtc
tacgaaagagctgactggccaagagaaaagttgttggactacttcaagaacgacactttt
gctttgatcggttacggttcccaaggttacggtcaaggtttgaacttgagagacaacggt
ttgaacgttatcattggtgtccgtaaagatggtgcttcttggaaggctgccatcgaagac
ggttgggttccaggcaagaacttgttcactgttgaagatgctatcaagagaggtagttac
gttatgaacttgttgtccgatgccgctcaatcagaaacctggcctgctatcaagccattg
ttgaccaagggtaagactttgtacttctcccacggtttctccccagtcttcaaggacttg
actcacgttgaaccaccaaaggacttagatgttatcttggttgctccaaagggttccggt
agaactgtcagatctttgttcaaggaaggtcgtggtattaactcttcttacgccgtctgg
aacgatgtcaccggtaaggctcacgaaaaggcccaagctttggccgttgccattggttcc
ggttacgtttaccaaaccactttcgaaagagaagtcaactctgacttgtacggtgaaaga
ggttgtttaatgggtggtatccacggtatgttcttggctcaatacgacgtcttgagagaa
aacggtcactccccatctgaagctttcaacgaaaccgtcgaagaagctacccaatctcta
tacccattgatcggtaagtacggtatggattacatgtacgatgcttgttccaccaccgcc
agaagaggtgctttggactggtacccaatcttcaagaatgctttgaagcctgttttccaa
gacttgtacgaatctaccaagaacggtaccgaaaccaagagatctttggaattcaactct
caacctgactacagagaaaagctagaaaaggaattagacaccatcagaaacatggaaatc
tggaaggttggtaaggaagtcagaaagttgagaccagaaaaccaataa

DBGET integrated database retrieval system