KEGG   Saccharomyces cerevisiae (budding yeast): YLR357WHelp
Entry
YLR357W           CDS       T00005                                 

Gene name
RSC2
Definition
(RefSeq) Rsc2p
  KO
K11756  chromatin structure-remodeling complex subunit RSC1/2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YLR357W (RSC2)
   03036 Chromosome and associated proteins [BR:sce03036]
    YLR357W (RSC2)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    RSC complex
     YLR357W (RSC2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Chromatin remodeling factors
   RSC complex
    YLR357W (RSC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bromodomain BAH
Motif
Other DBs
NCBI-GeneID: 851071
NCBI-ProteinID: NP_013461
SGD: S000004349
UniProt: Q06488
Structure
PDB: 

Position
XII:841331..844000
Genome map
AA seq 889 aa AA seqDB search
MMPDDNSNSSTQNSSALYKDLRKEYESLFTLKEDSGLEISPIFNVLPPKKDYPDYYAVIK
NPVSFNTLKKRIPHYTDAQQFMNDVVQIPWNAKTYNTRDSGIYKYALVLEKYLKDTIYPN
LKEKYPQLVYPDLGPLPDEPGYEEFQQKLREKAEEVARANAARAESSSSMNSTEAARRLR
KTRTSVKRESEPGTDTNNDEDYEATDMDIDNPKDADFPDLIRKPLININPYTRKPLRDNR
STTPSHSGTPQPLGPRHRQVSRTQVKRGRPPIIDLPYIQRMKNVMKVLKKEVLDSGIGLT
DLFERLPDRHRDANYYIMIANPISLQDINKKVKTRRYKTFQEFQNDFNLMLTNFRISHRG
DPESIKISNILEKTFTSLARFELSKPDRSFIPEGELRYPLDEVIVNNISYHVGDWALLRN
QNDPQKPIVGQIFRLWKTPDGKQWLNACWYYRPEQTVHRVDRLFYKNEVMKTGQYRDHLV
SNLVGKCYVIHFTRYQRGNPDMKLEGPLFVCEFRYNESDKIFNKIRTWKACLPEEIRDLD
EATIPVNGRKFFKYPSPIRHLLPANATPHDRVPEPTMGSPDAPPLVGAVYMRPKMQRDDL
GEYATSDDCPRYIIRPNDSPEEGQVDIETGTITTNTPTANALPKTGYSSSKLSSLRYNRS
SMSLENQNAIGQQQIPLSRVGSPGAGGPLTVQGLKQHQLQRLQQQQHQYQQQKRSQASRY
NIPTIIDDLTSQASRGNLGNIMIDAASSFVLPISITKNVDVLQRTDLHSQTKRSGREEMF
PWKKTKGEILWFRGPSVIVNERIINSGDPHLSLPLNRWFTTNKKRKLEYEEVEETMEDVT
GKDKDDDGLEPDVENEKESLPGPFVLGLRPSAKFTAHRLSMLRPPSSSS
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctgatgacaattcaaactcgtccactcaaaactcaagcgcattatacaaggac
ctgaggaaagaatatgaatctcttttcactttaaaggaagattctgggttagagatttca
ccaatattcaatgtccttccacctaaaaaggattatcctgactactacgcagtgatcaag
aaccctgtatctttcaatactttaaaaaagcgtattccacattatacagatgctcaacag
tttatgaacgatgttgtccagattccatggaatgccaagacttacaatacaagagattca
ggaatttataaatacgccttagtccttgagaaatatttaaaggacacaatctatccaaat
ttaaaagaaaaatatcctcaattagtgtatcctgatttgggtcctctacccgatgaacca
ggttatgaagagtttcaacagaaattaagagaaaaagctgaggaagtagcgagagctaat
gcagccagagccgagtcgagctcttcaatgaattcaacagaagcagccagaagattaaga
aagactcgtacttccgtcaaaagagaatcagaaccaggaaccgatacaaataatgatgag
gactatgaggcgacggatatggatatcgataaccctaaggatgctgattttcctgatttg
ataagaaagccactaataaatattaatccatatactcggaaaccattaagagacaacagg
tccactactccatctcactcaggcacccctcagccgttaggcccaaggcatagacaggta
tccagaactcaggtaaagcgtgggagacccccaatcatcgacttaccgtatattcaaaga
atgaaaaatgttatgaaagtactaaaaaaagaggtgctagatagtggaattggtctaact
gatctttttgaaagattgcccgatagacacagagatgcaaattactacatcatgattgct
aatccaattagtcttcaagacataaataaaaaggtaaagactcgtcgttataaaacgttc
caggagttccagaatgattttaatcttatgttaaccaactttagaatttcgcacagaggt
gatcctgaaagcataaaaatttcaaatatcttagaaaagacctttactagtctggcaaga
ttcgaactatccaaacctgatagaagtttcattccagaaggcgagctaagataccctcta
gatgaagtcattgtaaataatatatcataccacgtgggagattgggcacttcttcgaaat
caaaatgatcctcaaaaacctatagtgggccaaatattcaggctatggaagacaccagat
gggaaacaatggttaaacgcttgttggtattacagacccgaacaaactgtgcatagagtg
gatagattgttttacaaaaacgaagttatgaaaacaggtcagtaccgtgatcatttagtg
tcaaacttagttgggaaatgctatgtgattcactttactagatatcaacgtggtaatccc
gatatgaaattggagggtcccttgttcgtttgcgaattccgttataatgaatccgataaa
atttttaacaagattagaacctggaaggcttgcttaccagaggaaattcgtgatttggac
gaagctaccattccggtaaatggtagaaagttcttcaaatatccttcccccataagacat
ctactaccagctaatgcaacgccgcatgatcgcgttcctgaaccaacgatgggatccccg
gacgcgccaccattggtcggtgccgtttatatgagacctaaaatgcagcgtgacgatttg
ggggaatatgcaacctctgatgactgtcccaggtatattatcagacccaacgattctccc
gaagagggacaagtggatatagaaacaggtacgatcaccacaaacacgccaacagcaaat
gctcttcctaaaacaggatactcaagtagtaaactatccagtttaagatataacaggtca
tctatgtctttagaaaaccaaaatgctattggccagcaacaaataccactgtcaagagtt
ggttcccctggcgcgggaggcccgcttactgtacaaggtttaaagcaacaccaattgcaa
aggttacaacagcagcaacatcaataccaacaacagaaaagatcccaagcatcacgttat
aatatcccaacaataatcgatgatttaacatcgcaggcatcaagaggtaatttgggtaat
ataatgatcgatgcagcctcctcgtttgtcttacctatctctataaccaaaaacgtagat
gttttgcagcgtactgatctgcacagccaaaccaagagatctggaagagaagagatgttt
ccatggaaaaaaacaaagggtgaaatattatggttcagaggacctagtgtgatagtaaat
gaacgaataataaattcaggtgacccacacctaagcctgccactgaataggtggtttacc
actaacaagaaaagaaaactagaatacgaagaagttgaagaaaccatggaagatgtgact
ggaaaggacaaagatgatgatggcttagaaccggatgttgaaaatgagaaagagtccttg
ccaggcccatttgtccttggattaagaccctcggctaagttcacggcgcacagactctct
atgctgcggcctccttcgtcgtcttcatga

DBGET integrated database retrieval system