KEGG   Saccharomyces cerevisiae (budding yeast): YLR359WHelp
Entry
YLR359W           CDS       T00005                                 

Gene name
ADE13, BRA1, BRA8
Definition
(RefSeq) adenylosuccinase ADE13
  KO
K01756  adenylosuccinate lyase [EC:4.3.2.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00230  Purine metabolism
sce00250  Alanine, aspartate and glutamate metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
Module
sce_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YLR359W (ADE13)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YLR359W (ADE13)
Enzymes [BR:sce01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     YLR359W (ADE13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ADSL_C DUF1331
Motif
Other DBs
NCBI-GeneID: 851073
NCBI-ProteinID: NP_013463
SGD: S000004351
UniProt: Q05911
Position
XII:844282..845730
Genome map
AA seq 482 aa AA seqDB search
MPDYDNYTTPLSSRYASKEMSATFSLRNRFSTWRKLWLNLAIAEKELGLTVVTDEAIEQM
RKHVEITDDEIAKASAQEAIVRHDVMAHVHTFGETCPAAAGIIHLGATSCFVTDNADLIF
IRDAYDIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL
RNFERARNDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTY
SRKIDIDVLAPLSSFAATAHKMATDIRLLANLKEVEEPFEKSQIGSSAMAYKRNPMRCER
VCSLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTADILLSTLLNISSGLV
VYPKVIERRIKGELPFMATENIIMAMVEKNASRQEVHERIRVLSHQAAAVVKEEGGENDL
IERVKRDEFFKPIWEELDSLLEPSTFVGRAPQQVEKFVQKDVNNALQPFQKYLNDEQVKL
NV
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcctgactatgacaattacactacgccattgtcttctagatatgcctccaaggaaatg
tcagcaacgttttctttgagaaacagattttccacatggagaaaactatggttaaatttg
gctattgctgagaaggaattgggcttaactgttgttacagatgaagcaattgagcaaatg
cgcaaacacgtcgaaatcactgatgatgaaatcgcaaaagcttctgctcaagaagccatt
gtaagacatgatgttatggcacatgttcatacatttggtgaaacttgtccggctgctgcg
ggtatcattcacttaggtgctacttcctgtttcgttacagacaatgctgatctaatcttt
attagggacgcctacgatattattattccaaaacttgttaacgtcatcaacagattggct
aagtttgctatggaatacaaggatttgcctgtattgggttggactcactttcaaccagca
caattaacgaccttgggtaagagagctactttatggatacaagagctattgtgggatttg
agaaactttgaaagagctagaaacgatatcggtctacgtggtgttaagggtactactggt
actcaggcatcattcttggccttattccatggtaatcatgataaagttgaagcccttgac
gaaagagtaactgaattattaggtttcgataaggtatatccagtcactggtcaaacctac
tcaagaaaaattgacattgacgtgttggctcctttgtcttcttttgctgctactgcacac
aaaatggctactgacataagattattagccaacctgaaggaagttgaggaaccttttgag
aaatcacaaatcggatcctctgctatggcttacaagagaaacccaatgcgttgtgagaga
gtgtgctccttggctagacacttaggttccttgtttagtgacgccgttcaaactgcatcc
gttcaatggttcgaaagaactctggatgattctgctattagaagaatttctttaccaagt
gcatttttaaccgcagatattctattatctactttgttgaacatctcatccggtttagtt
gtgtatccaaaggttatcgaaaggagaattaagggtgaactaccttttatggctactgaa
aatatcatcatggctatggtagaaaagaatgcctccagacaagaagtacatgagcgtatt
agagtgctctctcatcaagccgcagcagtagtcaaggaagaaggtggggaaaatgattta
attgaacgagtaaagagggatgaatttttcaagcctatctgggaagaattagattcttta
ctggaaccatccacttttgttggtagagctccacaacaagttgagaaatttgttcaaaaa
gacgttaacaatgctttacaacctttccaaaagtacctaaacgatgaacaagtcaagtta
aatgtttag

DBGET integrated database retrieval system