KEGG   Saccharomyces cerevisiae (budding yeast): YLR361CHelp
Entry
YLR361C           CDS       T00005                                 

Gene name
DCR2
Definition
(RefSeq) phosphoprotein phosphatase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos Metallophos_2 OapA_N
Motif
Other DBs
NCBI-GeneID: 851075
NCBI-ProteinID: NP_013465
SGD: S000004353
UniProt: Q05924
Position
XII:complement(847388..849124)
Genome map
AA seq 578 aa AA seqDB search
MIRLPRLYQRYLLYLVVFVVIALFYFLQAPRVEEHIGFDLALPISHVDNLWFQNKGLEGF
SNDDKLVVNIGYDECFHIGRFYEGCFNRHELKSTLTDGHQYLQRKRIHKDLRGSFGRRWF
GKSEYLYYDVLYPALVDYFGSNLEKLNVEAVTGISKYPKDKSLPFMDVSITFEPISIELL
QKRSYISDINILFGVDCIQPIANWTLQKEFPLVKYRYSEPAYLTYKFVGTRPVDTGAQRL
QETDEGKFKIVQLADLHLGVGESECIDEYPKHEACKADPKTETFVQQVLDIEKPQLVVFT
GDQIMGDRSIQDSETVLLKAVAPVIARKIPWAMVWGNHDDEGSLTRWQLSEIASVLPYSL
FKFSPHDTHDNTFGVGNYIYQIFSNNDTEVPVGTLYFLDSHKYSTVGKIYPGYDWIKESQ
WKYIEDYHDVNLKFKTGLSMAFFHIPLPEYLNIESKTHPGEKNPLIGMYKEGVTAPKYNS
EGITTLDRLSVDVVSCGHDHCNDYCLRDDSTPNKIWLCYGGGGGEGGYAGYGGTERRIRI
YEINVNENNIHTWKRLNGSPKEIFDFQSMLDGNSPESV
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgatccggttaccgaggctgtatcaaaggtacctattatacttggtagtttttgtagtg
attgccctattttacttcctacaggcgccaagagttgaagagcacattggtttcgacctt
gcactcccgatatcacacgttgataatctatggttccaaaataaaggtctagagggattc
tcaaatgacgataagctagttgtaaatataggctatgacgaatgttttcatattggtcgt
ttttatgaaggatgttttaatcggcatgaacttaaatcaactttaactgatgggcaccaa
tacttacaaaggaaaagaattcataaagacttgagaggttcctttggacgcaggtggttt
ggaaagtcagaatacctttactatgatgtgttataccctgctttggtggactactttgga
tccaacctagaaaagctaaatgttgaggcagtaactggaatttccaaatatcctaaagac
aaatcgctaccctttatggatgtatccatcacattcgagcctattagcatagaactattg
cagaaaaggagctacataagcgatattaacattctctttggtgttgattgcatccagccg
atagcaaattggactcttcaaaaagaatttcccttagtaaaataccgctacagcgaacct
gcttatttgacttacaaattcgttggtactcgtcctgtagacacaggagctcaacggctg
caagaaactgatgaaggaaagttcaaaattgttcagttggcggatctccacttgggtgtg
ggggagtctgaatgtatcgatgagtatccaaagcatgaagcttgcaaggcagatccaaaa
acggaaactttcgttcaacaagttcttgacattgaaaaaccgcagttggttgtttttact
ggtgaccaaatcatgggtgatagatctattcaagactctgaaaccgtattattaaaggcg
gtagcacccgtcattgcaagaaaaattccgtgggcaatggtatggggaaatcacgacgac
gagggaagcttaacgcgctggcagttatccgaaatagcttcagtactaccatattccctt
ttcaagtttagtccccatgatacacacgataatacgtttggcgttggtaattatatttat
cagattttttcgaacaatgatacagaagtcccagtaggtacactttattttctggactca
cataaatattctacggttggtaaaatttatcctggatatgattggattaaggaatcacag
tggaaatacattgaagattatcatgatgtgaacttgaagttcaaaacaggtctttcaatg
gcattttttcacatcccactgccagaatacttgaatattgaatccaagacacatcccgga
gagaaaaatcccctcattggaatgtacaaagaaggtgttactgcacctaagtataattct
gaggggataacaactttggataggttaagtgtggatgtcgtcagttgcggacatgaccat
tgtaacgattactgtcttcgagatgactctacgccgaacaaaatctggctatgctatggc
ggtggaggtggagaaggtggttatgctggctatggaggtacagaaagacgtatccgtatt
tatgaaattaatgtaaatgagaacaatatacacacatggaaaagattaaatggcagtcca
aaagagatttttgattttcagtctatgttggacggtaattctccagaatctgtttaa

DBGET integrated database retrieval system