KEGG   Saccharomyces cerevisiae (budding yeast): YLR362WHelp
Entry
YLR362W           CDS       T00005                                 

Gene name
STE11
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase STE11
  KO
K11228  mitogen-activated protein kinase kinase kinase [EC:2.7.11.25]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YLR362W (STE11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YLR362W (STE11)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     YLR362W (STE11)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: STE group
  STE11 family
   YLR362W (STE11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Ras_bdg_2 SAM_2 SAM_1 Kinase-like SAM_4 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 851076
NCBI-ProteinID: NP_013466
SGD: S000004354
UniProt: P23561
Structure
PDB: 

Position
XII:849866..852019
Genome map
AA seq 717 aa AA seqDB search
MEQTQTAEGTDLLIGDEKTNDLPFVQLFLEEIGCTQYLDSFIQCNLVTEEEIKYLDKDIL
IALGVNKIGDRLKILRKSKSFQRDKRIEQVNRLKNLMEKVSSLSTATLSMNSELIPEKHC
VIFILNDGSAKKVNVNGCFNADSIKKRLIRRLPHELLATNSNGEVTKMVQDYDVFVLDYT
KNVLHLLYDVELVTICHANDRVEKNRLIFVSKDQTPSDKAISTSKKLYLRTLSALSQVGP
SSSNLLAQNKGISHNNAEGKLRIDNTEKDRIRQIFNQRPPSEFISTNLAGYFPHTDMKRL
QKTMRESFRHSARLSIAQRRPLSAESNNIGDILLKHSNAVDMALLQGLDQTRLSSKLDTT
KIPKLAHKRPEDNDAISNQLELLSVESGEEEDHDFFGEDSDIVSLPTKIATPKNWLKGAC
IGSGSFGSVYLGMNAHTGELMAVKQVEIKNNNIGVPTDNNKQANSDENNEQEEQQEKIED
VGAVSHPKTNQNIHRKMVDALQHEMNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGS
VSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGI
SKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPFPDF
SQMQAIFKIGTNTTPEIPSWATSEGKNFLRKAFELDYQYRPSALELLQHPWLDAHII
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggaacagacacaaacagcagagggcactgacttactaattggtgacgaaaagaccaac
gatttaccttttgtgcagttatttctggaggaaataggatgcactcaatacctggatagc
tttattcagtgcaaccttgtcacagaagaagaaattaagtatctcgacaaggatatcctc
attgctttgggtgtaaacaaaataggagacagactcaaaattttaaggaagtcaaaatcg
ttccagagagataaacggattgaacaggtgaatagattgaaaaacctgatggaaaaagta
agctctctatccactgctacgctatcgatgaattcagaattgattcctgaaaagcactgt
gttatatttatcttaaacgatggttccgctaagaaagttaatgtaaatggttgctttaat
gcagattctattaagaaaaggctaatcagaagattgccacatgaattattagccacaaac
tccaatggagaagtaactaaaatggtccaagattatgatgtgtttgtcttagattatacc
aagaacgtactgcatttgctatatgacgtggaattagtcactatttgccacgcaaatgat
cgtgttgagaaaaataggctaatttttgtttccaaagaccaaacaccaagtgataaagct
atatccacatccaaaaaactatatctaagaacgttgagtgcattgagccaggttgggcca
tcctcgtcaaatttgttggcacagaacaaggggatttcgcataacaatgctgaagggaaa
ctccggatcgacaacacagaaaaggacagaattagacagatttttaatcagaggcctcct
agcgaatttatttctaccaatttggccggatattttcctcatacagacatgaagcggttg
caaaagacgatgagagagtcatttcgccattcagcaaggctaagcattgctcaaagaaga
cctttaagtgcagaatcaaataatatcggtgacatactattgaaacactcaaacgctgtt
gatatggccctattacaaggattagatcagacaagattaagcagtaaacttgacacaact
aaaattccgaagcttgcccataaaaggccagaagataatgatgccatatctaaccagtta
gaactattaagtgtagagtctggtgaagaagaagatcacgatttctttggggaggacagt
gacattgtttcattaccgacgaaaattgccacgcccaagaattggttaaaaggtgcttgc
attggatcaggcagttttgggagtgtttacttgggcatgaatgctcacactggtgaacta
atggcagtaaagcaagtggagataaaaaataataacattggtgttcccacagacaacaat
aaacaagccaattctgatgagaataatgagcaggaggaacaacaagagaaaatagaagat
gttggggcggtaagtcatccaaaaaccaatcaaaatattcacagaaagatggttgatgct
ttacagcatgaaatgaatttattgaaggagttacatcatgagaacattgttacttattat
ggtgcttctcaagaaggcggaaatttaaatatttttcttgaatacgttcctgggggttcg
gtttcctccatgctgaataattacggtccatttgaggaatcactgattactaatttcact
aggcaaatactgattggggttgcgtatttgcataagaagaacattattcacagagatatc
aagggtgcaaatattttgattgatatcaaaggttgcgtaaaaattactgattttggtatt
tcaaaaaaattatcacctttgaataaaaaacaaaataagagagcttctttgcaaggttcc
gtattctggatgtcaccagaggtggtcaaacagaccgctactactgctaaagcggatata
tggtctacaggatgtgttgtcattgaaatgtttaccggtaagcatcctttcccagatttt
tctcaaatgcaagcgatcttcaaaataggcacaaacacgacccccgagataccttcctgg
gctacgtcagaaggaaagaatttcttaagaaaggcatttgagttggattatcaatacagg
cctagtgcccttgaattgctgcagcatccatggctggatgcacacataatttga

DBGET integrated database retrieval system