KEGG   Saccharomyces cerevisiae (budding yeast): YLR364WHelp
Entry
YLR364W           CDS       T00005                                 

Gene name
GRX8
Definition
(RefSeq) glutathione-disulfide reductase GRX8
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaredoxin DUF953 Thioredoxin_9
Motif
Other DBs
NCBI-GeneID: 851079
NCBI-ProteinID: NP_013468
SGD: S000004356
UniProt: Q05926
Structure
PDB: 

Position
XII:854062..854391
Genome map
AA seq 109 aa AA seqDB search
MSAFVTKAEEMIKSHPYFQLSASWCPDCVYANSIWNKLNVQDKVFVFDIGSLPRNEQEKW
RIAFQKVVGSRNLPTIVVNGKFWGTESQLHRFEAKGTLEEELTKIGLLP
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctttgttactaaagctgaagagatgatcaaatctcatccatatttccagtta
tccgccagctggtgccccgactgcgtctatgctaattccatttggaataagttgaatgta
caggacaaagttttcgtttttgatattggttcacttccaagaaacgaacaggaaaaatgg
agaattgcgttccaaaaagttgttggtagcagaaacttaccaacgatagttgtcaatggt
aaattctggggtactgagagtcaattgcatagatttgaagcaaaaggcactcttgaggag
gaattgactaaaatcgggcttctgccttga

DBGET integrated database retrieval system