KEGG   Saccharomyces cerevisiae (budding yeast): YLR369WHelp
Entry
YLR369W           CDS       T00005                                 

Gene name
SSQ1, SSC2, SSH1
Definition
(RefSeq) Hsp70 family ATPase SSQ1
  KO
K04043  molecular chaperone DnaK
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    YLR369W (SSQ1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YLR369W (SSQ1)
   03110 Chaperones and folding catalysts [BR:sce03110]
    YLR369W (SSQ1)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YLR369W (SSQ1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YLR369W (SSQ1)
Messenger RNA biogenesis [BR:sce03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     YLR369W (SSQ1)
Chaperones and folding catalysts [BR:sce03110]
 Heat shock proteins
  HSP70 / DNAK
   YLR369W (SSQ1)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    YLR369W (SSQ1)
  Matrix
   MMC/PAM proteins
    YLR369W (SSQ1)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    YLR369W (SSQ1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YLR369W (SSQ1)
  Exosomal proteins of breast cancer cells
   YLR369W (SSQ1)
  Exosomal proteins of colorectal cancer cells
   YLR369W (SSQ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DUF87
Motif
Other DBs
NCBI-GeneID: 851084
NCBI-ProteinID: NP_013473
SGD: S000004361
UniProt: Q05931
Position
XII:859552..861525
Genome map
AA seq 657 aa AA seqDB search
MLKSGRLNFLKLNINSRLLYSTNPQLTKKVIGIDLGTTNSAVAYIRDSNDKKSATIIEND
EGQRTTPSIVAFDVKSSPQNKDQMKTLVGMAAKRQNAINSENTFFATKRLIGRAFNDKEV
QRDMAVMPYKIVKCESNGQAYLSTSNGLIQSPSQIASILLKYLKQTSEEYLGEKVNLAVI
TVPAYFNDSQRQATKDAGKLAGLNVLRVINEPTAAALSFGIDDKRNNGLIAVYDLGGGTF
DISILDIEDGVFEVRATNGDTHLGGEDFDNVIVNYIIDTFIHENPEITREEITKNRETMQ
RLKDVSERAKIDLSHVKKTFIELPFVYKSKHLRVPMTEEELDNMTLSLINRTIPPVKQAL
KDADIEPEDIDEVILVGGMTRMPKIRSVVKDLFGKSPNSSVNPDETVALGAAIQGGILSG
EIKNVLLLDVTPLTLGIETFGGAFSPLIPRNTTVPVKKTEIFSTGVDGQAGVDIKVFQGE
RGLVRNNKLIGDLKLTGITPLPKGIPQIYVTFDIDADGIINVSAAEKSSGKQQSITVIPN
SGLSEEEIAKLIEEANANRAQDNLIRQRLELISKADIMISDTENLFKRYEKLISSEKEYS
NIVEDIKALRQAIKNFKANENDMSIDVNGIKKATDALQGRALKLFQSATKNQQNQGK
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaatctggtagactcaactttctcaagttgaatatcaattcacgattactatac
tcaacgaaccctcaactgactaagaaggtcattggtatcgacctgggtaccacgaatagt
gctgttgcatatatccgtgattctaacgacaaaaaatcagctacaatcatagaaaatgat
gaaggacaacgaaccacaccatctatagttgcctttgatgtcaaaagctcgccacagaat
aaagatcaaatgaaaactcttgtagggatggcagctaaaaggcaaaatgctattaattct
gaaaacactttctttgctacaaagagacttattggccgtgcattcaacgacaaggaagtt
cagcgagatatggctgttatgccatataagattgtcaaatgtgagtcaaatgggcaagcc
tatctcagcacgtctaatggtctcattcaatcaccaagccagatagcatctatattactg
aaatacctgaaacaaacttcagaagaatacttaggcgaaaaggttaatttggcagttatt
acagttccagcatattttaatgattctcaaaggcaagccacaaaagatgccggcaagtta
gctggcctaaatgttttgagagttattaacgaaccaactgcggccgccttaagctttgga
attgatgataagaggaataatggattaattgcagtttacgatttgggtggtggtacattt
gacatatccatcttggacattgaagatggcgtgtttgaggttcgtgctactaatggtgac
acgcatttaggtggagaagattttgacaacgtcattgtaaactatattatagataccttc
attcatgaaaaccctgaaattacacgggaagaaattacgaagaacagggagacaatgcaa
aggttaaaagatgtttctgaaagagctaagatagatttatcccatgtgaagaaaactttt
atcgaacttccatttgtatacaaaagcaaacatctacgagtgccaatgacagaggaagag
ctggataatatgactttgtcattaatcaacaggactatcccacctgtgaagcaagcattg
aaagatgccgatatcgaaccggaggatatagatgaagtaatccttgttggtggtatgacc
cgtatgccaaagattagatctgttgtaaaagatctttttggtaagtctccaaattctagt
gttaacccagatgaaacagttgctttaggagcagctattcaaggtggtattctatccggt
gaaataaagaatgtcttacttttggatgtgacaccattgacattagggattgaaacattt
ggaggagcgttctcacccttgatacctagaaatacgacagttccagtaaaaaaaacagag
atatttagtactggtgttgatgggcaagcgggtgttgatatcaaagtttttcagggtgaa
agagggttagtgcgtaacaacaagttgattggtgatttgaaacttacaggaatcacccct
ttgcctaaaggcattccccaaatatatgttacttttgatatcgatgcggatggtatcatc
aacgtatctgccgctgagaaaagtagtgggaaacaacaatccattactgtaataccaaat
tctgggttaagcgaagaggaaattgcaaaacttattgaagaagcaaatgcaaatagggca
caagataacttgatcaggcaaaggttagagcttatctctaaggctgacattatgataagt
gatactgagaatttatttaaaagatatgaaaaactgatttctagcgaaaaagagtattct
aatatcgtagaggacatcaaagctctgagacaagctataaagaattttaaggctaacgaa
aatgacatgtcaattgatgtaaacggaataaaaaaagctacggatgcgctacagggtagg
gcattaaaattattccaaagcgcaacaaaaaaccagcagaatcaaggtaaataa

DBGET integrated database retrieval system