KEGG   Saccharomyces cerevisiae (budding yeast): YLR394W
Entry
YLR394W           CDS       T00005                                 

Gene name
CST9, ZIP3
Definition
(RefSeq) SUMO ligase CST9
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: zf-RING_5 Prok-RING_4 zf-C3HC4_3 Defensin_int
Other DBs
NCBI-GeneID: 851110
NCBI-ProteinID: NP_013498
SGD: S000004386
UniProt: Q06032
Position
XII:907950..909398
AA seq 482 aa
MGGYLAIVFIPQTNTKSMREKKQKCLKQVRRLSLISPKKYIMPDSIFEQPFVYCGVCHRR
TSHGDPLRLTSCAHILCSQHSPLTSKVCPICRSSDISIINLVESKQLPTDIRIFFEPLPP
LLESLYNVSQFQLNGLSKQCQYYQNHCLKLREKCARQQQLLYQAKIELDSMAILKKRIQE
LESVLNHNNVSSMSVGVLPTRNSHQNHYQPPPTVDLTVDDNSLEEFEAKSFIKKLKKNSS
LRNSSKNNNGTVTPSTSGRVNKNQPLFMETLNNPNRNSIPPPGMNPNANSNLPNISTIAE
STNLNRFSFSPVRVAKGFDGKLPNLDILTNNGSVSSKNISRLSSASLQPSSPLSSSSNRL
ILPNSNLKELHHSNTPLTSTSTQFPSALEKLKITRKRNNTISGSNRITHNLSSHVRSSGL
AFSSSSNSLQQSKLPKSNILKRSNSTQQLTNTHLKSDNHLPPRSSNTVLGSSKKNNKFRR
IR
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgggcggctatttggcgatcgtgttcattccccaaactaacacgaagagcatgagagag
aaaaaacaaaagtgcttgaaacaggtaagacgtttatcattgatatcaccaaagaaatat
ataatgccggattctatttttgaacagccctttgtttactgtggtgtttgccacagaaga
acatcgcatggagatccattgaggctgacctcatgtgctcatatcctctgttcgcagcat
tctccattaacatcaaaggtgtgtcctatatgccgttcgagcgatatctccatcattaac
cttgtggaatctaaacagctgcctaccgacattaggattttttttgagccactgccccca
cttttggagtcgttatataatgtttcccaattccaactgaatgggctttcgaaacagtgt
caatactatcaaaatcattgtttaaagttgagagaaaaatgtgcaagacaacagcagctg
ctatatcaggccaaaatagagttggattctatggcgattcttaagaaaagaatacaggaa
ttagagtcagttttgaatcataacaatgtttcttcgatgtcagttggtgtgctaccaaca
agaaatagccatcaaaatcattaccagccccctccaaccgttgatctgacagttgatgat
aatagtttagaagaattcgaagccaaatcctttattaaaaagttgaaaaaaaactcttct
ttgagaaattcttcaaaaaataacaatggaactgtcactccctctacaagtggtcgtgta
aataaaaaccagcctctctttatggagacattgaataatcctaatagaaatagcattcct
cctcctggaatgaacccaaacgcaaatagtaatctacctaatatttcgactattgcagaa
tcaaccaatctgaacagattttcgttctctcctgtgcgtgttgcaaaaggcttcgatgga
aagttgccaaatcttgacatcctcacgaataatggctctgtatcttccaaaaatatatca
agattatcttcagcttctctccaaccctcttcgcctctatcttcatcatcaaataggctt
attttaccaaatagtaacctcaaagaattgcatcattcaaatacacctttaacaagtacc
tcgacgcagtttccctcagctttagaaaaattaaaaataacaaggaagagaaataatact
atcagcggttcgaatagaataacacacaacttgagctcacacgtaagaagcagtggtctt
gccttttcatcttcatcgaactcattgcaacaaagtaaactgccgaaatcaaatatacta
aagcggtccaattcaactcagcaactgactaatacacatttgaagagtgataatcatctg
ccacctcgctcaagtaatactgtgttgggtagtagcaagaaaaacaataagtttagaagg
attaggtaa

DBGET integrated database retrieval system