KEGG   Saccharomyces cerevisiae (budding yeast): YLR401CHelp
Entry
YLR401C           CDS       T00005                                 

Gene name
DUS3
Definition
(RefSeq) tRNA dihydrouridine synthase DUS3
  KO
K05544  tRNA-dihydrouridine synthase 3 [EC:1.3.1.89]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YLR401C (DUS3)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.89  tRNA-dihydrouridine47 synthase [NAD(P)+]
     YLR401C (DUS3)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  tRNA modification factors
   Dihydorouridine synthases
    YLR401C (DUS3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dus zf-CCCH_4 zf_CCCH_4 zf-CCCH
Motif
Other DBs
NCBI-GeneID: 851117
NCBI-ProteinID: NP_013505
SGD: S000004393
UniProt: Q06053
Position
XII:complement(922442..924448)
Genome map
AA seq 668 aa AA seqDB search
MEQNAEKRSIVGDDNSTVKRQDTSPSKGIAHIKPEYIVPLKQNENQKVAIYDEEMSSDRM
TNEFAGGTNKKNKNGRGKKRGQNKNRDNRQVKEQNVLCPRLIHGDISKCSFGDNCRFVHD
INLYLSTKKPEVESNIFPSCPVFNSLGFCPMGFKCRFLSSHLNKEDNILISKKEIDPDAQ
TIWSVKGEVNHISPERKLDLIKRRFPFTKSNEILEIIDSFQQECRDSMKPEEEVESTPQL
KKQDPDVEQPVAPQVEQRNKELSEHRMKQREVYLKYKDTRYFAQEKKPLDLYHKKIVSPL
TTVGNLPYRRLMRKLGADVTYSEMALAVPLIQGTNSEWALPKAHTSEFPGFGVQVACSKA
WQAAKAAEALANSVSEISEINLNSGCPIDLLYRQGSGSALLDNPARMIRCLNAMNYVSKD
IPITVKIRTGTKEGHPIAEGLVKRLVNETDVAAITLHGRSRQQRYTKSADWDYVSQVADT
LRSAEADFIETEQGKEGRDSKNRIQFVGNGDVNNFEDWYRYLNGNENIDSVMVARGALIK
PWIFEEVESQQYLDKTSTERLDILRDYAQFSMEHWGTDEYGISQCRRFFCEFMSFFHRYV
PMGICERYPVKLNERPPNWCGRDELETLMGSTDVNDWIKLSDLFFGKTDENFVFVPKHKS
SSYANRDS
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaaacgctgaaaaacgctctattgttggcgacgacaactcaaccgtgaagaga
caagacacttccccgtccaaaggtattgcacatatcaaaccagaatatattgtaccattg
aagcagaatgaaaaccagaaggtcgccatctatgatgaagagatgtcttccgacagaatg
acaaacgagtttgcaggtgggactaataagaaaaataagaacggaagaggtaagaagcgt
gggcaaaacaagaatagagataacaggcaggtcaaggaacagaatgtcttgtgcccacgc
ttgatccatggcgatatatctaaatgctcctttggtgataactgtaggtttgttcacgat
atcaatctgtacctttcaacaaaaaagcctgaagttgaaagtaatatatttccttcctgt
ccggtcttcaactcgttgggattttgccccatgggattcaaatgcagatttttatcgtct
catctgaataaagaagataatatcctaatatcgaagaaggagattgatccagatgcgcaa
acaatatggtccgttaaaggtgaggtaaaccatatctcaccggaaagaaaactcgatctt
ataaaaagaagatttcctttcacaaaaagtaatgaaatattggaaatcatcgactctttc
caacaagaatgtagagattccatgaagccagaagaagaagttgagtcaacgccacagctg
aagaaacaagacccagatgtggaacaaccagttgccccccaagtcgaacagaggaacaaa
gaattgtcagaacatagaatgaaacagcgtgaagtatacttgaagtacaaggacactcgt
tattttgctcaagaaaaaaagccactggatttgtaccacaaaaaaatcgtgtcgccattg
acaaccgtaggcaatttaccataccgtcgtctaatgagaaagttaggtgcagatgtgaca
tattcggaaatggccttggcagttcccttaattcaaggaactaattctgagtgggcgtta
cctaaagctcacacatcagagttccccgggttcggggttcaagtggcctgttctaaagcc
tggcaggcggcaaaggctgcagaagcactcgcaaactccgtcagtgaaataagtgaaatc
aacttaaactctggctgccccatcgatttgctatacagacaaggttctggtagcgccctg
ctggataaccctgcaagaatgattcgttgtttaaacgcgatgaactacgtatcgaaagat
attcctatcacggtgaagatcagaacaggtacaaaggaaggtcatcctatcgcggaaggg
ttagtcaaaagactggttaacgaaactgatgtggctgcgattaccttacacggtaggtct
aggcaacaaaggtacactaagtctgcggattgggactacgtgagtcaagtggctgacacc
ttgagatccgccgaagcggatttcatcgaaaccgaacaaggcaaagaaggcagggattcc
aagaacagaattcaatttgtcggaaatggtgatgtcaacaattttgaagactggtaccgc
tatttgaacggaaatgaaaatattgatagtgttatggttgctcgaggggccctgatcaaa
ccatggatttttgaagaggttgagtcgcagcagtatctagacaagacaagtacggaaaga
ttagacattttaagggattatgcgcagttctctatggaacactggggcaccgacgaatac
ggcatttctcaatgtcgtagattcttctgcgagttcatgtccttttttcataggtatgtc
cccatgggtatttgtgaaagataccctgtgaagttgaatgagagaccgccaaactggtgt
ggaagagacgaacttgaaactctaatgggtagtacggatgttaatgattggatcaagcta
agtgatctatttttcggtaaaaccgacgagaactttgtatttgtccccaaacataagagc
agctcttatgcaaacagagattcctaa

DBGET integrated database retrieval system