KEGG   Saccharomyces cerevisiae (budding yeast): YLR405WHelp
Entry
YLR405W           CDS       T00005                                 

Gene name
DUS4
Definition
(RefSeq) tRNA dihydrouridine synthase
  KO
K05545  tRNA-dihydrouridine synthase 4 [EC:1.3.1.90]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YLR405W (DUS4)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.90  tRNA-dihydrouridine20a/20b synthase [NAD(P)+]
     YLR405W (DUS4)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  tRNA modification factors
   Dihydorouridine synthases
    YLR405W (DUS4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dus
Motif
Other DBs
NCBI-GeneID: 851121
NCBI-ProteinID: NP_013509
SGD: S000004397
UniProt: Q06063
Position
XII:929789..930892
Genome map
AA seq 367 aa AA seqDB search
MHTMHIPSGDVLIPKPKLITEETDPLHIIKTRQKTHGRPVTIAGPMVRYSKLPFRQLCRE
YNVDIVYSPMILAREYVRNEHARISDLSTNNEDTPLIVQVGVNNVADLLKFVEMVAPYCD
GIGINCGCPIKEQIREGIGCALIYNSDLLCSMVHAVKDKYGDKLRIETKIRIHEALDETV
ELCRKLCDAGVDWITIHGRTRRTRSSQPANLDAIKYIIENISDKNVPVIANGDCFKLSDL
ERITKYTGAHGVMAVRGLLSNPALFAGYTTCPWGCIEKFCYWALEFGGLPFQLAQHHLYC
MLENMELKKSLLKKMMNLKNYISLIDWFNKTFEFKRYGEDGFGMGVEIPYKANSCVQRSA
SVVERQE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcacacaatgcatattccatccggtgatgttctgataccgaagccgaagcttattact
gaagaaacagatccactgcatataataaagacgaggcaaaagacacatggtcggcccgtg
accattgcaggcccaatggttcggtattccaagttaccattccgtcagttgtgccgagaa
tataacgttgatatagtttactcccccatgattttggcaagagaatatgtccgtaatgag
catgcaagaatctcagacctttctacaaataatgaggacaccccgctaatcgtccaagta
ggtgtaaataacgtggctgatttactaaaatttgtggaaatggttgccccatactgtgat
ggtattggtattaactgtggttgtcctataaaggaacaaatccgagagggcataggttgc
gctctgatatacaattcagatttgttatgcagtatggtccatgctgtgaaagataagtat
ggcgacaaactaagaattgaaacgaaaataagaatacatgaggcattggacgagacggtg
gagttatgtagaaagctatgtgatgctggggtagattggattacgattcatggccgaaca
cgtagaactaggtcatcgcagccggctaacctggatgcgataaaatatatcatcgagaac
atcagcgacaaaaatgtgcctgtaatagcgaatggggattgttttaagttatccgatttg
gaaagaatcaccaaatacactggtgcacatggtgtcatggctgtgcgtgggttgttaagc
aatccagcgttatttgctggatatactacctgcccttggggctgcattgagaagttttgt
tattgggctctagagtttggtggcttgccttttcaattggctcagcaccatctgtactgt
atgcttgaaaatatggagttgaagaaatctctgttaaagaaaatgatgaatcttaaaaat
tacattagtctgatcgactggtttaataaaacctttgagttcaagcgttacggcgaggat
ggatttggcatgggcgttgaaattccttataaagctaatagctgtgtgcagaggagcgcc
tcagtggttgagagacaagaatga

DBGET integrated database retrieval system