KEGG   Saccharomyces cerevisiae (budding yeast): YLR406CHelp
Entry
YLR406C           CDS       T00005                                 

Gene name
RPL31B
Definition
(RefSeq) ribosomal 60S subunit protein L31B
  KO
K02910  large subunit ribosomal protein L31e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Module
sce_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YLR406C (RPL31B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YLR406C (RPL31B)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    YLR406C (RPL31B)
  Archaea
    YLR406C (RPL31B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L31e
Motif
Other DBs
NCBI-GeneID: 851122
NCBI-ProteinID: NP_013510
SGD: S000004398
UniProt: P0C2H9
Position
XII:complement(join(931065..931349,931699..931755))
Genome map
AA seq 113 aa AA seqDB search
MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTEDVRLAPELNQAIW
KRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVASAKGLQTVVVEEDA
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggccggtttaaaagacgttgtcactcgtgaatacaccatcaacttgcacaaaagacta
catggtgtcagtttcaaaaagagagctccaagagctgtgaaggaaatcaagaaattcgcc
aaattacacatgggtactgaagatgtccgtctagccccagaattgaaccaagctatctgg
aaaagaggtgttaagggtgttgaatacagattgagattgagaatctccagaaagagaaac
gaagaagaagatgccaagaacccattgttttcctacgtcgaaccagttttggttgcctct
gctaagggtctacaaaccgttgtcgttgaagaagatgcttaa

DBGET integrated database retrieval system