KEGG   Saccharomyces cerevisiae (budding yeast): YLR409CHelp
Entry
YLR409C           CDS       T00005                                 

Gene name
UTP21
Definition
(RefSeq) rRNA-processing protein UTP21
  KO
K14554  U3 small nucleolar RNA-associated protein 21
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    YLR409C (UTP21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YLR409C (UTP21)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    YLR409C (UTP21)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Utp21 ANAPC4_WD40 WD40 eIF2A PQQ_2 Cytochrom_D1
Motif
Other DBs
NCBI-GeneID: 851125
NCBI-ProteinID: NP_013513
SGD: S000004401
UniProt: Q06078
Structure
PDB: 

Position
XII:complement(934414..937233)
Genome map
AA seq 939 aa AA seqDB search
MSIDLKKRKVEEDVRSRGKNSKIFSPFRIIGNVSNGVPFATGTLGSTFYIVTCVGKTFQI
YDANTLHLLFVSEKETPSSIVALSAHFHYVYAAYENKVGIYKRGIEEHLLELETDANVEH
LCIFGDYLCASTDDNSIFIYKKSDPQDKYPSEFYTKLTVTEIQGGEIVSLQHLATYLNKL
TVVTKSNVLLFNVRTGKLVFTSNEFPDQITTAEPAPVLDIIALGTVTGEVIMFNMRKGKR
IRTIKIPQSRISSLSFRTDGSSHLSVGTSSGDLIFYDLDRRSRIHVLKNIHRESYGGVTQ
ATFLNGQPIIVTSGGDNSLKEYVFDPSLSQGSGDVVVQPPRYLRSRGGHSQPPSYIAFAD
SQSHFMLSASKDRSLWSFSLRKDAQSQEMSQRLHKKQDGGRVGGSTIKSKFPEIVALAIE
NARIGEWENIITAHKDEKFARTWDMRNKRVGRWTFDTTDDGFVKSVAMSQCGNFGFIGSS
NGSITIYNMQSGILRKKYKLHKRAVTGISLDGMNRKMVSCGLDGIVGFYDFNKSTLLGKL
KLDAPITAMVYHRSSDLFALALDDLSIVVIDAVTQRVVRQLWGHSNRITAFDFSPEGRWI
VSASLDSTIRTWDLPTGGCIDGIIVDNVATNVKFSPNGDLLATTHVTGNGICIWTNRAQF
KTVSTRTIDESEFARMALPSTSVRGNDSMLSGALESNGGEDLNDIDFNTYTSLEQIDKEL
LTLSIGPRSKMNTLLHLDVIRKRSKPKEAPKKSEKLPFFLQLSGEKVGDEASVREGIAHE
TPEEIHRRDQEAQKKLDAEEQMNKFKVTGRLGFESHFTKQLREGSQSKDYSSLLATLINF
SPAAVDLEIRSLNSFEPFDEIVWFIDALTQGLKSNKNFELYETFMSLLFKAHGDVIHANN
KNQDIASALQNWEDVHKKEDRLDDLVKFCMGVAAFVTTA
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcgacttgaaaaaaagaaaagtcgaagaagacgtaagaagtagagggaaaaat
tctaagatattttcccctttccggattattggtaatgttagcaatggtgttccttttgct
actggtacattgggatctaccttttacattgtaacgtgtgttggtaaaacatttcagata
tatgatgcgaataccttacatttactttttgtttccgagaaagaaacaccatcctcaatt
gtagcattatcagcacactttcactacgtctacgcagcatatgaaaacaaggttggtatt
tacaagaggggtattgaggaacatttgcttgagctagaaactgatgcaaatgtcgaacat
ttgtgcatattcggagattatctttgcgcttccaccgacgacaattccatctttatatac
aagaagtccgatccgcaagataaatatccatcagaattctacactaaacttaccgttact
gaaattcaaggtggcgaaattgtgtctttacaacatttggcaacttatttgaataaatta
actgtcgttaccaaatctaacgttttactttttaacgtcagaaccgggaagcttgtattc
acatcaaacgaatttccagaccaaatcacaactgctgaacccgctccagtcctggatatt
attgctctaggtaccgtgaccggtgaggttattatgtttaatatgagaaaaggtaaaagg
atccgcacaattaagattccgcaatcaagaatctcctcattgagtttcagaaccgacggt
tcttctcatttgagtgtgggaacgagcagtggtgatctaatattttatgatttagatcgc
cgttcaagaatacacgttttgaagaacattcatagagaatcgtacggtggtgtcactcag
gctacttttttaaatggtcaacccattattgttacatcaggtggtgacaattccctgaag
gagtacgttttcgatccgtcattatctcaaggaagcggtgatgtagttgttcaaccgcca
agatatctacgttccagagggggtcattctcaaccaccttcatacattgcgtttgctgat
tcgcaatcacacttcatgctatcagcatccaaagatagatcattatggagcttttctctg
cgtaaagatgcacagtcgcaagaaatgtcacaaaggttacacaagaaacaagatggcggc
agggtaggtggtagtacaattaagtctaaatttcctgaaatagtggctcttgcaattgaa
aatgccagaataggtgaatgggaaaacattatcactgcacataaagatgaaaagtttgca
agaacctgggatatgcgaaataaaagagttggcaggtggacttttgatactactgatgat
ggatttgttaaatctgtggccatgtcgcaatgtggtaattttggattcatcggttcttct
aacggctctatcaccatctataatatgcaaagtggtatactccgtaaaaaatacaaattg
cacaaaagagcagtcaccggtatatccttagatggtatgaatcgtaaaatggtttcttgt
ggactagacggtattgttggtttttatgactttaacaagtcaaccttgttgggaaaattg
aaattggatgcacctattaccgcaatggtttatcatcgttcttccgatctatttgcattg
gctttagacgacttatcaattgttgttattgacgcagttactcaaagagttgttcgtcaa
ttatggggtcatagtaatagaataactgcatttgatttctcacctgagggccgttggatt
gtttccgcttctctagattccaccattagaacgtgggatcttccaaccggaggatgtatc
gatggtatcatagtagataatgtcgctacgaatgtaaagttttctccgaatggtgacttg
cttgccactacccatgttactggtaatggtatatgcatctggacgaacagagcacaattt
aagacagtatcgacaagaaccatcgatgagtctgaatttgcaagaatggcgttacctagc
acatctgttcgagggaacgactcgatgttatcaggggctttagaaagcaatggaggagaa
gacctaaatgatattgatttcaacacttatacatcattggaacagattgataaggagctg
ttgactttatcaataggacctagaagtaaaatgaacacattgcttcatttagatgttatc
agaaaacgttctaagccaaaggaagctccaaagaaatcagaaaagcttccatttttcttg
caactatctggggaaaaggttggggatgaagcctctgtcagagaaggcatagcacatgaa
acaccagaagaaatccatcgcagagatcaagaagcacaaaagaagttagatgcagaagag
caaatgaataaattcaaagttacaggaagattagggtttgaatcacatttcacaaagcaa
ttacgagagggctcacaatccaaggactattcatcattgctggccactctaataaatttc
tcacctgctgcagtggatttggagataagatcattgaattcctttgagccatttgatgaa
attgtgtggtttatcgacgcgttaacacaggggttgaagagcaataaaaatttcgaactt
tatgaaacgtttatgagcttactgtttaaggcacacggtgatgttattcatgctaacaac
aagaatcaagatattgcctctgctcttcaaaattgggaggatgtacataagaaggaagac
agattagatgatcttgtgaagttttgcatgggagtggcagcttttgtgaccaccgcgtga

DBGET integrated database retrieval system