KEGG   Saccharomyces cerevisiae (budding yeast): YLR410WHelp
Entry
YLR410W           CDS       T00005                                 

Gene name
VIP1
Definition
(RefSeq) inositol polyphosphate kinase VIP1
  KO
K13024  inositol-hexakisphosphate/diphosphoinositol-pentakisphosphate 1-kinase [EC:2.7.4.24]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    YLR410W (VIP1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.24  diphosphoinositol-pentakisphosphate kinase
     YLR410W (VIP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2 PPIP5K2_N RimK LEM
Motif
Other DBs
NCBI-GeneID: 851126
NCBI-ProteinID: NP_013514
SGD: S000004402
UniProt: Q06685
Position
XII:937541..940981
Genome map
AA seq 1146 aa AA seqDB search
MSGIKKEPIESDEVPQQETKNNLPSAPSEMSPLFLNKNTQKAMQSIAPILEGFSPKTSAS
ENMSLKLPPPGIQDDHSEENLTVHDTLQRTISTALGNGNNTNTVTTSGLKKADSESKSEA
DPEGLSNSNIVNDADNINSISKTGSPHLPQGTMDAEQTNMGTNSVPTSSASSRKSSTSHP
KPRLPKVGKIGVCAMDAKVLSKPMRHILNRLIEHGEFETVIFGDKVILDERIENWPTCDF
LISFFSSGFPLDKAIKYVKLRKPFIINDLIMQKILWDRRLCLQVLEAYNVPTPPRLEISR
DGGPRANEELRAKLREHGVEVKPVEEPEWKMVDDDTLEVDGKTMTKPFVEKPVDGEDHNI
YIYYHSKNGGGGRRLFRKVGNKSSEFDPTLVHPRTEGSYIYEQFMDTDNFEDVKAYTIGE
NFCHAETRKSPVVDGIVRRNTHGKEVRYITELSDEEKTIAGKVSKAFSQMICGFDLLRVS
GKSYVIDVNGFSFVKDNKAYYDSCANILRSTFIEAKKKMDMEKKNLPIIREEKEQKWVFK
GLAIIIRHADRTPKQKFKHSFTSPIFISLLKGHKEEVVIRNVNDLKIVLQALRIALDEKA
GNPAKIKVLANALEKKLNFPGTKIQLKPVLNKENEVEKVQFILKWGGEPTHSAKYQATEL
GEQMRQDFDLLNKSILQNIKIFSSSERRVLHTAQYWTRALFGADELGSDEISIRKDLLDD
SNAAKDLMDKVKKKLKPLLREGKEAPPQFAWPSKMPEPYLVIKRVVELMNYHKKIMDNNF
AKKDVNSMQTRWCTSEDPSLFKERWDKLFKEFNNAEKVDPSKISELYDTMKYDALHNRQF
LENIFDPGLPNEAIADELGSHSLVDRYPINVLAKNNFKIIDSHSMNNSGKNSSNSVGSLG
WVLESGKTSTARNPKSSSQFDEPRFMQLRELYKLAKVLFDFICPKEYGISDAEKLDIGLL
TSLPLAKQILNDIGDMKNRETPACVAYFTKESHIYTLLNIIYESGIPMRIARNALPELDY
LSQITFELYESTDASGQKSHSIRLKMSPGCHTQDPLDVQLDDRHYISCIPKISLTKHLDM
DYVQQKLRNKFTRVIMPPKFTPVNITSPNLSFQKRKTRRKSVSVEKLKRPASSGSSSSTS
VNKTLD
NT seq 3441 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggataaagaaggaaccgattgaatctgatgaggttcctcaacaagagacaaaa
aataacttacctagtgcaccttctgagatgtcaccccttttcctaaacaaaaacacacag
aaggctatgcaatctattgcaccaatattggagggtttcagtcctaagacgtcagctagc
gaaaatatgtctttgaaattgccacctcccggtattcaagatgatcacagtgaagagaat
ctcaccgtgcatgatactctgcaaagaaccataagcactgcactaggaaacggaaacaac
accaatacagttacaacttccggtttaaaaaaggcagacagtgaatcaaagtcagaagct
gatcctgaggggctcagcaattctaacatagtcaatgatgcagataacataaattccatc
tccaagaccggatcgccccatttacctcaaggaacaatggacgctgagcagactaacatg
ggaactaactctgtacctacttcatcagcttcttcacgcaaatcctcgactagtcatccc
aaacctaggctacccaaggtagggaagattggggtatgtgcaatggatgcaaaagtcctt
tcaaagccaatgagacacattttgaatcgtttaattgaacatggtgaatttgaaactgtc
atttttggagataaggtgattctagatgaaagaatagagaattggccaacttgcgacttt
ttgatatctttcttttcttcaggatttcccctagataaagcaattaaatacgtcaagtta
cgcaagcctttcattatcaatgatttaataatgcaaaagattttgtgggacaggagatta
tgtctacaagtattagaagcctacaacgttccaacacctcctagactggaaatcagtaga
gatggtggtccccgtgccaacgaagaattaagggcaaaattacgtgagcatggcgtagaa
gttaaacccgttgaagaaccggaatggaaaatggttgatgatgatactttagaagttgat
gggaaaaccatgactaagccctttgttgaaaagcccgttgatggtgaagaccacaacatt
tatatatactatcattctaagaacggaggaggcggtcgtcgtctattccgtaaagttggt
aacaagtcttctgagtttgatcctactttggttcatcctcgtacggaggggtcttacatt
tatgagcagtttatggataccgataatttcgaagatgtgaaggcttatacgattggtgag
aacttttgtcacgctgaaactaggaaatcacctgtggttgatggtatagttagaagaaat
actcatggtaaagaagttagatatattactgagttatcagacgaagagaaaaccattgct
gggaaagtttccaaagctttttcacaaatgatctgtggtttcgatttgcttcgcgtttct
ggtaaaagttacgtcattgatgttaacggattttcttttgtaaaggataacaaagcttac
tatgattcatgcgccaatatattgagaagtaccttcattgaagccaaaaagaagatggat
atggaaaagaagaatctgcccattattcgtgaagaaaaggaacaaaagtgggtattcaaa
ggactggctatcattatccgtcacgcggacagaacaccaaaacagaaattcaaacattca
ttcacttcgcctatttttatatcgttactaaaaggtcacaaagaagaagttgtcattcgg
aatgtaaatgatttaaagattgttcttcaggccttaagaattgcgttagatgaaaaagca
ggaaatccagctaaaattaaagtgttagcaaacgctctagaaaagaaactgaattttccc
ggtacgaaaatacaattgaaaccggttttaaataaagagaacgaagtggaaaaagttcag
tttattttgaaatggggtggtgaacccactcattctgccaaatatcaggctacggaactc
ggagagcaaatgagacaagattttgacctattgaataagagcattctacaaaacatcaag
atattttcatcgtctgagagacgtgttcttcatacggcgcagtactggaccagagctctt
tttggggccgatgaattaggtagcgatgaaatcagtattagaaaggatcttttagatgac
agtaatgccgccaaagatttaatggataaggtgaaaaagaagttgaagccacttttaaga
gagggtaaggaagctcccccacaatttgcctggccttcaaagatgccggagccatattta
gtcataaagcgagtggttgaattgatgaattaccataaaaaaattatggataacaacttt
gctaaaaaggatgtcaactcgatgcaaacaagatggtgtacttctgaagatcctagtttg
tttaaggaaaggtgggataaacttttcaaagaattcaataatgctgaaaaagtcgatcct
tctaaaatttctgaattgtatgatactatgaagtatgatgctcttcacaacaggcagttc
ctagagaacatatttgacccgggtcttccaaatgaagctatcgccgatgaactcggcagt
cattctttagttgaccgatacccaattaacgttctcgccaaaaataattttaagataata
gacagtcatagcatgaacaattctggaaagaacagtagtaatagtgttgggtcgttagga
tgggttctggaaagcggaaaaacatctacagcaagaaaccccaaatcttcttctcaattc
gatgagccacgctttatgcagttgcgggagctgtataagctggccaaagtattgtttgat
tttatctgccccaaagaatatggtatttcagatgcagagaaactggatatcggtttgtta
acttcgttgcctttggcaaagcaaatactaaatgatataggagacatgaaaaatagagaa
actccagcttgtgttgcgtacttcaccaaagagtcccatatttacactctattgaatatc
atatacgaatctggtattccaatgagaatcgctagaaatgctttaccagaactagactac
ttgtcgcagatcacttttgaactttatgagagtacggatgcttctggtcaaaaatcgcat
tccattagactaaaaatgtctcctgggtgtcatactcaagatccgttagatgttcaatta
gatgacaggcattatattagttgtattccaaagatttccctgacgaagcatttggatatg
gactatgttcaacagaaattgagaaacaaatttaccagggtcattatgcctccgaaattt
acaccagtaaacattacgagccccaacttgagtttccagaaacgcaaaaccagaagaaag
tcggtatctgttgagaagttgaaacgtcctgcctcgtccggatcttcatcatctacctcc
gttaacaagacattagattag

DBGET integrated database retrieval system