KEGG   Saccharomyces cerevisiae (budding yeast): YLR447C
Entry
YLR447C           CDS       T00005                                 

Symbol
VMA6
Name
(RefSeq) H(+)-transporting V0 sector ATPase subunit D
  KO
K02146  V-type H+-transporting ATPase subunit d
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00190  Oxidative phosphorylation
sce01100  Metabolic pathways
sce04145  Phagosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    YLR447C (VMA6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    YLR447C (VMA6)
SSDB
Motif
Pfam: vATP-synt_AC39 BRCT_2
Other DBs
NCBI-GeneID: 851168
NCBI-ProteinID: NP_013552
SGD: S000004439
UniProt: P32366
Structure
PDB: 

Position
XII:complement(1026856..1027893)
AA seq 345 aa
MEGVYFNIDNGFIEGVVRGYRNGLLSNNQYINLTQCDTLEDLKLQLSSTDYGNFLSSVSS
ESLTTSLIQEYASSKLYHEFNYIRDQSSGSTRKFMDYITYGYMIDNVALMITGTIHDRDK
GEILQRCHPLGWFDTLPTLSVATDLESLYETVLVDTPLAPYFKNCFDTAEELDDMNIEII
RNKLYKAYLEDFYNFVTEEIPEPAKECMQTLLGFEADRRSINIALNSLQSSDIDPDLKSD
LLPNIGKLYPLATFHLAQAQDFEGVRAALANVYEYRGFLETGNLEDHFYQLEMELCRDAF
TQQFAISTVWAWMKSKEQEVRNITWIAECIAQNQRERINNYISVY
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggaaggcgtgtatttcaatattgacaatgggtttattgaaggtgtagtgagaggctac
agaaatgggttgttatctaataaccaatacatcaacttaacacaatgtgacacgttggaa
gatctaaaattacaattatcatcaactgattatggtaattttctttcctctgtttcctca
gagtctttgaccacgtcattgattcaagaatatgcttctagcaagttgtaccacgaattc
aactacataagagaccaatccagtggatccacgagaaagttcatggactatatcacttat
ggttacatgatcgacaatgtagcattgatgattacaggtactattcatgatcgtgataag
ggtgaaattttacaacgttgtcatccgctaggttggtttgatactttgcctacgttgagt
gttgctactgatcttgaatccctatacgaaaccgtattggtggataccccactggcacct
tacttcaaaaactgttttgacacggcagaggagctagacgatatgaacattgaaattatt
agaaataagctgtacaaggcttatttagaagacttttacaattttgtcactgaagaaatt
ccggaacctgctaaagaatgtatgcaaacattactagggtttgaagctgacagaagaagt
atcaatattgcactcaactctttgcaaagttcagatattgacccagatttgaaaagtgac
ttgttacctaacataggtaagttgtaccctcttgcaacgtttcacttggcgcaagcccaa
gatttcgaaggagttagagctgctttagctaacgtctatgagtataggggatttttggag
actggtaacttagaagatcacttttaccaattggaaatggaactatgtagagatgctttc
acgcaacaatttgccatcagcactgtttgggcctggatgaaatccaaggaacaagaagtt
aggaatattacctggattgcagaatgtatcgcacaaaaccaaagagaaagaatcaacaat
tatatttccgtttattga

DBGET integrated database retrieval system