KEGG   Saccharomyces cerevisiae (budding yeast): YML013WHelp
Entry
YML013W           CDS       T00005                                 

Gene name
UBX2, SEL1
Definition
(RefSeq) Ubx2p
  KO
K14013  UBX domain-containing protein 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YML013W (UBX2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UBX UBA_4 DUF4335
Motif
Other DBs
NCBI-GeneID: 854995
NCBI-ProteinID: NP_013699
SGD: S000004475
UniProt: Q04228
Position
XIII:244149..245903
Genome map
AA seq 584 aa AA seqDB search
MPVVNHEDSEFHLSHTEEDKLNEFQVITNFPPEDLPDVVRLLRNHGWQLEPALSRYFDGE
WKGEPDQMGEPTQTSTPMAETLVPPALGPRPLLFTASLPVVRPLPANFRNDFRTIGLNGR
SNTVWSMFESFSYDGNPFLFILLLIPRIINRLSATIFTFFCTLLSLHSISGGGNSGKPKI
SKVPKAPTRETHIPLAEILGDTKDKDAFCELKSFKPDISFNEALRIAKEEFKFMLLILVG
DTYDTDTDTVDVNSKLLLEKILLNKKTLQYLRKIDNDLIIYLKCVHELEPWLVARQLGVR
NTPEIFLIANVANKASHSETLPSQRLSILGKLKVNSLNRFLQSLTNVVEKYTPELVVNKT
EMHELRMSREIKKLQEDAYKKSLEMDRIKAIEKEKSLKHAQDLKLNSTARQLKWLKACID
EIQPFETTGKQATLQFRTSSGKRFVKKFPSMTTLYQIYQSIGCHIYLAVYSSDPAEWSNA
LQDKIRQLSADDDMLCFKEGQLETATATTIEELGHIINNELTSFDLERGKLEFDFELVSP
FPKYTVHPNEHMSVDQVPQLWPNGSLLVEALDEEDEEDEENEEQ
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgccagtagtcaatcatgaggatagtgaatttcacctttcgcacacagaagaggacaag
ttaaatgagttccaggtcatcacgaatttccccccagaagacttgccagatgtggtgaga
ctgttgaggaaccatggttggcagttagaaccagcattgagccgatatttcgatggagag
tggaaaggcgaaccagaccagatgggagagcccactcaaacgtctacacccatggctgag
accttggttcctcccgcgttgggacctagaccgttgttatttacagcctcactgcccgtg
gtcagaccattgccagcgaacttccgcaatgatttcagaacaattgggctaaatggacgc
tctaacactgtgtggtccatgtttgaatcttttagttatgatggtaacccctttcttttt
attttactgttgatccctcggataatcaataggttatctgccacaatattcacgttcttt
tgcactctattgtccctgcattcgataagtggtggcggtaattcaggaaaacccaagatc
tccaaggttccaaaggcaccaaccagagaaacccatatcccacttgcagaaatactgggt
gacacgaaggacaaggatgcattttgcgaactaaaaagctttaaaccagacatttccttc
aatgaggccttgcgtattgcaaaagaagagtttaagtttatgttgctcatcctagtgggc
gacacctacgataccgatactgataccgtagatgttaattctaaactactattggaaaag
attttgttaaacaagaagactttacagtacttgcgcaagattgataacgacctgattatc
tatttgaaatgcgtacacgagttggaaccttggctggttgctcgccaactaggtgtcaga
aacaccccggagatattcctcattgccaacgtggctaataaggcttcccattcagaaact
ttgccctcacaaagactctccattctcggcaagctaaaggtcaattcactgaacagattc
ttgcagtcgttaacaaacgtggtggaaaagtacactccagaattagttgttaataaaact
gaaatgcacgagctacgcatgtcaagagaaataaaaaaactgcaggaggatgcgtacaaa
aagtcgctagaaatggacagaatcaaagctatagaaaaggaaaagagcttgaaacacgct
caggatttgaaattaaactcaactgctcggcaattaaaatggttaaaggcttgcatcgat
gagatacagccgttcgagacaacggggaagcaagctactctgcaatttaggacttctagt
ggcaaaagattcgtcaagaagttcccctccatgactacactttaccaaatctaccaatcc
attgggtgtcacatatacctcgcggtatattctagtgaccccgcagaatggtctaacgcc
ctccaggacaaaatcaggcaattatctgcagacgacgatatgctctgctttaaagaagga
caactcgaaactgctactgctaccactatcgaagagctcggccacatcatcaacaacgag
cttacctcatttgatctcgaacgtggtaaacttgaattcgactttgaattggtatcgccc
ttccctaagtatactgtgcatcctaacgagcacatgtcggtggaccaagtgccccagcta
tggccaaatggcagtcttctagtggaagcactggatgaagaagatgaagaagatgaggaa
aatgaagaacaatga

DBGET integrated database retrieval system