KEGG   Saccharomyces cerevisiae (budding yeast): YML014WHelp
Entry
YML014W           CDS       T00005                                 

Gene name
TRM9, KTI1
Definition
(RefSeq) tRNA (carboxymethyluridine(34)-5-O)-methyltransferase
  KO
K15444  tRNA (uracil-5-)-methyltransferase TRM9 [EC:2.1.1.229]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YML014W (TRM9)
Enzymes [BR:sce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.229  tRNA (carboxymethyluridine34-5-O)-methyltransferase
     YML014W (TRM9)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  tRNA modification factors
   Methyltransferases
    YML014W (TRM9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_12 Methyltransf_23 Methyltransf_31
Motif
Other DBs
NCBI-GeneID: 854994
NCBI-ProteinID: NP_013698
SGD: S000004476
UniProt: P49957
Position
XIII:243225..244064
Genome map
AA seq 279 aa AA seqDB search
MEINQAAEKEQEYVHKVYNEIAPHFSQTRYKPWPIVTQFLKTRPMGSIGIDVGCGNGKYL
GVNPDIYIIGSDRSDGLIECARGINPSYNLLVADGLNLPHKNETFDFAISIAVVHHWSTR
ERRVEVIRHVLSKLRQGGQALIYCWALEQGSSRRGYHEGMEQDVFVPWVLPKSKSKPKTK
STPPAKVKTRPKPNLMNIPPKERSEYLQRWKEEQQRSKSLDDNDEKQQQDQEQEREEVKY
RYYHLYREGELAEDCRQAGAAVHSEGFERDNWWVVAQKR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggagataaaccaagcggctgaaaaagaacaggagtatgttcacaaagtgtataatgag
atagctccgcatttctcgcaaactagatataagccatggcccatagtgactcagttcttg
aagactcgcccaatgggttccatcggtatcgacgtcgggtgtggcaatggaaagtacctc
ggagtgaaccctgatatatatattatcggttcagatcgctcagatggtcttattgagtgc
gccagaggaataaacccatcgtacaacttactggtggcagacgggctgaacttaccacac
aaaaacgaaacatttgacttcgccatctcaattgctgtagtgcatcactggtctacaagg
gagagacgtgttgaggtgatcaggcacgttctatcgaagctacgtcagggcggacaagca
ttaatatattgttgggctctagaacagggcagctcccgtagaggttaccatgaaggtatg
gagcaagatgtctttgtcccctgggttcttcccaagagtaaatccaaaccaaaaactaaa
tcaacgccgcctgctaaagtcaagacaaggccaaagccaaacttaatgaatattccccca
aaggagcgttccgaatacttgcagcgctggaaggaggaacagcaacgcagtaagtctctt
gatgataacgacgagaagcaacaacaagatcaagaacaggaaagagaagaggtaaaatac
cgatactatcacttataccgagagggcgaattggctgaggattgccgccaagctggggct
gccgttcatagtgagggcttcgagcgcgacaattggtgggtggtggcccagaagagatga

DBGET integrated database retrieval system