KEGG   Saccharomyces cerevisiae (budding yeast): YML016CHelp
Entry
YML016C           CDS       T00005                                 

Gene name
PPZ1
Definition
(RefSeq) salt homeostasis regulator
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03015  mRNA surveillance pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    YML016C (PPZ1)
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YML016C (PPZ1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YML016C (PPZ1)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YML016C (PPZ1)
   03019 Messenger RNA biogenesis [BR:sce03019]
    YML016C (PPZ1)
   03041 Spliceosome [BR:sce03041]
    YML016C (PPZ1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     YML016C (PPZ1)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     YML016C (PPZ1)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     YML016C (PPZ1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     YML016C (PPZ1)
Spliceosome [BR:sce03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    YML016C (PPZ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 854992
NCBI-ProteinID: NP_013696
SGD: S000004478
UniProt: P26570
Position
XIII:complement(239458..241536)
Genome map
AA seq 692 aa AA seqDB search
MGNSSSKSSKKDSHSNSSSRNPRPQVSRTETSHSVKSAKSNKSSRSRRSLPSSSTTNTNS
NVPDPSTPSKPNLEVNHQRHSSHTNRYHFPSSSHSHSNSQNELLTTPSSSSTKRPSTSRR
SSYNTKAAADLPPSMIQMEPKSPILKTNNSSTHVSKHKSSYSSTYYENALTDDDNDDKDN
DISHTKRFSRSSNSRPSSIRSGSVSRRKSDVTHEEPNNGSYSSNNQENYLVQALTRSNSH
ASSLHSRKSSFGSDGNTAYSTPLNSPGLSKLTDHSGEYFTSNSTSSLNHHSSRDIYPSKH
ISNDDDIENSSQLSNIHASMENVNDKNNNITDSKKDPNEEFNDIMQSSGNKNAPKKFKKP
IDIDETIQKLLDAGYAAKRTKNVCLKNNEILQICIKAREIFLSQPSLLELSPPVKIVGDV
HGQYGDLLRLFTKCGFPPSSNYLFLGDYVDRGKQSLETILLLFCYKIKYPENFFLLRGNH
ECANVTRVYGFYDECKRRCNIKIWKTFIDTFNTLPLAAIVAGKIFCVHGGLSPVLNSMDE
IRHVVRPTDVPDFGLINDLLWSDPTDSPNEWEDNERGVSYCYNKVAINKFLNKFGFDLVC
RAHMVVEDGYEFFNDRSLVTVFSAPNYCGEFDNWGAVMSVSEGLLCSFELLDPLDSAALK
QVMKKGRQERKLANQQQQMMETSITNDNESQQ
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgggtaattcaagttcaaaatcttcgaaaaaggattcacattcgaattcctcctcgaga
aatcctcgtcctcaagtgtcgagaaccgagacttcccattctgtgaagtctgcaaaatca
aataaatcttcaagatcaaggcgatctcttccttcttcgtccactacgaatactaattca
aacgtccctgatccctccactccatcaaagcccaatcttgaggttaatcaccaacgacat
agctctcacacgaatcgttaccatttcccatctagctcacactcgcattcaaattctcaa
aacgaattgttaactactccttcatcatcctctactaagaggccttctacttctagaaga
tcaagttataatactaaggctgctgctgatttaccaccttcaatgatccaaatggaaccc
aagtcacccattttaaaaacaaacaatagtagcacacacgtatccaagcataaatcttca
tactcatctacctattatgagaacgccttaaccgatgatgacaatgatgataaagacaac
gacatctcgcacactaaaaggttttctagatcttcgaattctcgtccgtccagtataaga
agcggatcagtgtcaagaaggaaatcagatgtgacccatgaagagcctaacaatggatca
tactcctctaacaatcaggagaattatctcgttcaggcattaacccggtcaaattctcat
gcatcttcgctacacagtaggaaatcttcgtttggatcagatggtaataccgcatacagc
accccattaaactctccaggcttgtccaagctaacagatcactctggtgaatactttacc
tctaattcaacctcctcattgaatcaccattcaagtcgcgatatttacccgagcaaacac
atcagcaatgatgatgacattgaaaattcatctcaattgagtaatatccatgcatcaatg
gaaaatgttaatgataaaaataataatataacagatagcaaaaaagatccgaatgaggaa
tttaatgatataatgcaatcttccggaaacaaaaacgctccaaaaaaattcaaaaagcct
atcgatattgatgaaactatccaaaaattactggatgcgggctacgctgctaagagaaca
aaaaatgtttgtttgaagaacaatgaaattttacagatttgcatcaaggctcgtgaaatc
tttctttctcaaccttccttattagaattatcacctcctgtaaaaattgtaggcgacgtt
catggccaatatggggatctcttaaggctttttaccaaatgtgggttcccaccatcctcg
aactatttattcctaggtgattatgtggaccgtggtaaacagtcactggagactatttta
ctattgttttgttacaaaataaaataccctgaaaatttctttttattgagaggcaaccat
gaatgtgctaacgtcacaagggtttatggattttatgatgaatgtaaacgtcgttgtaac
atcaagatctggaagacattcatcgatacttttaatacattaccattagctgctatcgta
gccggaaagattttttgtgttcatggtggattgtcgccagttttaaattctatggatgaa
atcagacatgtagttaggcctactgatgtaccagattttggcttaattaatgatcttttg
tggtccgatcccacagattcacccaacgaatgggaggataacgaacgtggtgtaagttac
tgttataataaggtggcaattaacaaattcttgaacaagtttgggtttgatttggtttgt
agagctcacatggttgtggaagacggttatgaatttttcaatgatagaagtctcgttacg
gtgttttccgcgccaaattattgtggtgaatttgataattggggggctgtaatgagcgtc
agcgaaggtttattgtgctcttttgaattgttagatccactagatagtgcagctttgaag
caagttatgaagaaaggtagacaggaaagaaaactggctaatcaacaacagcaaatgatg
gaaacaagcatcacaaatgataacgaatctcaacagtaa

DBGET integrated database retrieval system