KEGG   Saccharomyces cerevisiae (budding yeast): YML018C
Entry
YML018C           CDS       T00005                                 
Name
(RefSeq) uncharacterized protein
  KO
K15289  solute carrier family 35, member F5
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YML018C
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   YML018C
SSDB
Motif
Pfam: EamA DUF3955
Other DBs
NCBI-GeneID: 854990
NCBI-ProteinID: NP_013694
SGD: S000004480
UniProt: Q03730
Position
XIII:complement(234771..235952)
AA seq 393 aa
MVSKDQTSFNKRWTLGLLMLGLVIILWVLSSFLINLIFEDDSYRKPFFITYTNTAAFIFY
LFPTAKAVVVNYKDTGRANVHRELIMEEEGTGSDSNRSVDMTSPLLTNLEAGTHANQKKR
LTLYETIKLSAEFCILWFTANLVTNASLAFTSVASQTILSTTSSFFTLFIGAICHVESLS
KSKVLGSFISFVGIIMVTKSDSHQRYQRHIADVSGDDNDAVQVLIGNLLALAGAVLYGVY
STLLKREVGDETRVNMKIFFGFVGLFNLLFLWPSLIVLDFFGWEPFSLPKDPKVVVIIFV
NCLITFVSDFCWAKAMLLTSPLTVTVGLSITIPLAMFGDVIFKHKTMSALYLFGATLILG
SFFIINKSSEEEHFENSITASNYESVEVPAANN
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggtgtcgaaggatcaaacgtcctttaataagaggtggaccttgggtcttctgatgttg
ggtctagtcattattttgtgggttttatcgtccttcctgataaatttgatcttcgaggat
gactcgtatagaaaaccattctttatcacgtacaccaatactgccgcctttatcttttat
ctttttccaactgcaaaggccgttgtggtgaattacaaggacacaggccgtgcaaacgtt
caccgcgaactaattatggaggaagaaggtactggtagtgatagcaatcgctcggttgat
atgactagcccactgcttacaaaccttgaagcaggcacgcatgccaaccaaaagaagagg
ctaacgttatatgaaacaatcaagttaagtgctgagttctgcatactttggttcacagct
aaccttgtgaccaatgcctcgctggcattcacatcggtggcatcgcagacaatcctctcc
actacttcttcctttttcaccttgttcataggtgctatttgtcatgttgaatcgttgagc
aagtccaaagtactcgggtcgttcatttcctttgtaggcataatcatggtcaccaaatca
gattctcatcagcgctaccaacgccatatcgcggacgttagtggtgatgataacgatgcc
gtgcaagttctgataggcaacttgttggcacttgcaggtgctgtactttacggtgtctac
agtactttattgaagagagaagtcggagatgagactcgtgttaacatgaagatttttttt
ggctttgttggtctctttaatttactttttctatggccatcactgattgtattggacttt
tttggctgggaaccattctctctgcccaaagatcctaaagttgtggtaataatcttcgtc
aattgtctcatcacatttgttagcgacttttgttgggcaaaggctatgttactaacgagt
cctttaaccgtcaccgtaggattgagcataacgatacccctagcaatgtttggtgatgta
atctttaagcacaaaaccatgtctgcgctctatttatttggtgctaccctcatcttaggc
tcatttttcatcattaacaaaagctctgaggaggaacattttgagaactcaataacggct
agcaattacgaatcagtggaggtgccagcagcaaacaactga

DBGET integrated database retrieval system