KEGG   Saccharomyces cerevisiae (budding yeast): YML019WHelp
Entry
YML019W           CDS       T00005                                 

Gene name
OST6
Definition
(RefSeq) dolichyl-diphosphooligosaccharide--protein glycotransferase
  KO
K12669  oligosaccharyltransferase complex subunit gamma
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00510  N-Glycan biosynthesis
sce00513  Various types of N-glycan biosynthesis
sce01100  Metabolic pathways
sce04141  Protein processing in endoplasmic reticulum
Module
sce_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    YML019W (OST6)
   00513 Various types of N-glycan biosynthesis
    YML019W (OST6)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YML019W (OST6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YML019W (OST6)
Transporters [BR:sce02000]
 Other Transporters
  Others
   YML019W (OST6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OST3_OST6 Thioredoxin
Motif
Other DBs
NCBI-GeneID: 854989
NCBI-ProteinID: NP_013693
SGD: S000004481
UniProt: Q03723
Structure
PDB: 

Position
XIII:233457..234455
Genome map
AA seq 332 aa AA seqDB search
MKWCSTYIIIWLAIIFHKFQKSTATASHNIDDILQLKDDTGVITVTADNYPLLSRGVPGY
FNILYITMRGTNSNGMSCQLCHDFEKTYHAVADVIRSQAPQSLNLFFTVDVNEVPQLVKD
LKLQNVPHLVVYPPAESNKQSQFEWKTSPFYQYSLVPENAENTLQFGDFLAKILNISITV
PQAFNVQEFVYYFVACMVVFIFIKKVILPKVTNKWKLFSMILSLGILLPSITGYKFVEMN
AIPFIARDAKNRIMYFSGGSGWQFGIEIFSVSLMYIVMSALSVLLIYVPKISCVSEKMRG
LLSSFLACVLFYFFSYFISCYLIKNPGYPIVF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggtgtagcacatacattattatatggctcgccattatattccataagtttcag
aagtccacagccactgcatcccataatatagatgatattctacagttgaaagatgacacc
ggtgtgataacagtgaccgctgacaactacccactgttaagccgtggtgtcccaggttac
ttcaatatcttgtacatcacaatgaggggtacaaacagtaacggcatgagttgccaacta
tgccatgattttgaaaaaacctatcacgcagtggccgatgtaattcgctcgcaggcccca
caatcactaaatttgttttttacagtggatgtcaacgaagtaccacaattggtcaaggat
ttaaagttgcaaaacgtacctcatcttgtggtatatccgccagcagaaagtaacaagcaa
tctcagttcgaatggaaaacatcacctttttatcagtactctttggtacctgaaaatgcg
gaaaacactttacaatttggcgattttctggctaaaatactcaatatttcgataacggtt
cctcaagccttcaacgttcaggaatttgtttattattttgttgcgtgtatggtagttttc
atctttattaagaaagtaattctaccgaaggtaactaataaatggaagcttttctccatg
atattgtcattaggcatacttctaccaagtattactggttacaagtttgtggaaatgaat
gctatccctttcattgcacgtgatgctaagaatcgtataatgtattttagcggtggttca
ggatggcagttcggtatagagattttttctgtatcattgatgtacattgtgatgtccgca
ctgtctgtgcttttaatttatgtgcccaaaatctcgtgtgtaagtgaaaaaatgagagga
ctattgtcgtcatttttggcatgtgttctattctacttcttttcttatttcattagttgt
tatttgataaagaatccagggtacccaattgttttttaa

DBGET integrated database retrieval system