KEGG   Saccharomyces cerevisiae (budding yeast): YML022WHelp
Entry
YML022W           CDS       T00005                                 

Gene name
APT1
Definition
(RefSeq) adenine phosphoribosyltransferase APT1
  KO
K00759  adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00230  Purine metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YML022W (APT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YML022W (APT1)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     YML022W (APT1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YML022W (APT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran UPRTase
Motif
Other DBs
NCBI-GeneID: 854986
NCBI-ProteinID: NP_013690
SGD: S000004484
UniProt: P49435
Structure
PDB: 

Position
XIII:228937..229500
Genome map
AA seq 187 aa AA seqDB search
MSIASYAQELKLALHQYPNFPSEGILFEDFLPIFRNPGLFQKLIDAFKLHLEEAFPEVKI
DYIVGLESRGFLFGPTLALALGVGFVPVRKAGKLPGECFKATYEKEYGSDLFEIQKNAIP
AGSNVIIVDDIIATGGSAAAAGELVEQLEANLLEYNFVMELDFLKGRSKLNAPVFTLLNA
QKEALKK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagcaagttatgcccaagagttgaagttggctttacatcaatatccaaacttc
cctagtgaaggcattctcttcgaagatttcttacccattttcaggaacccaggtcttttc
cagaagttgatcgatgctttcaaactgcatttagaagaagcttttccagaagttaaaatt
gattatatcgtcgggttggaatcccgtgggttcttgttcggaccaactttagctttggcc
ctaggtgttggtttcgttccagtcaggaaggcaggtaagctacctggcgaatgttttaag
gctacgtacgaaaaggagtacggttctgatctttttgagatacagaaaaacgctattcca
gcaggttccaacgttatcattgttgatgacattattgccactggtggttctgctgctgca
gccggcgaattagttgaacaactcgaagccaaccttttggaatataactttgttatggag
ttggatttcttgaaaggcaggagtaagttgaatgctccagtgttcactttactgaacgct
caaaaggaagcgttgaaaaaatga

DBGET integrated database retrieval system