KEGG   Saccharomyces cerevisiae (budding yeast): YML024WHelp
Entry
YML024W           CDS       T00005                                 

Gene name
RPS17A, RP51A, RPL51A
Definition
(RefSeq) ribosomal 40S subunit protein S17A
  KO
K02962  small subunit ribosomal protein S17e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Module
sce_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YML024W (RPS17A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YML024W (RPS17A)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    YML024W (RPS17A)
  Archaea
    YML024W (RPS17A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S17e
Motif
Other DBs
NCBI-GeneID: 854984
NCBI-ProteinID: NP_013688
SGD: S000004486
UniProt: P02407
Structure
PDB: 

Position
XIII:join(225889..225891,226290..226697)
Genome map
AA seq 136 aa AA seqDB search
MGRVRTKTVKRASKALIERYYPKLTLDFQTNKRLCDEIATIQSKRLRNKIAGYTTHLMKR
IQKGPVRGISFKLQEEERERKDQYVPEVSALDLSRSNGVLNVDNQTSDLVKSLGLKLPLS
VINVSAQRDRRYRKRV
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgggtagagttagaaccaagaccgtcaagcgtgcttctaaggctttgattgaacgttac
tatccaaagttgactttggatttccaaaccaacaagagactttgtgatgaaatcgccact
atccaatccaagagattgagaaacaagattgctggttacaccacccatttgatgaagaga
atccaaaagggtccagttagaggtatctctttcaaattgcaagaagaagaaagagaaaga
aaggaccaatacgtcccagaagtctctgctttggacttgtctcgttctaacggtgttttg
aacgttgacaaccaaacttctgacttggttaaatctttgggtttgaagttgccattatct
gttatcaacgtttctgcccaaagagacagacgttacagaaagagagtttaa

DBGET integrated database retrieval system