KEGG   Saccharomyces cerevisiae (budding yeast): YML025CHelp
Entry
YML025C           CDS       T00005                                 

Gene name
YML6
Definition
(RefSeq) mitochondrial 54S ribosomal protein YmL6
  KO
K02926  large subunit ribosomal protein L4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YML025C (YML6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YML025C (YML6)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    YML025C (YML6)
  Bacteria
    YML025C (YML6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L4
Motif
Other DBs
NCBI-GeneID: 854983
NCBI-ProteinID: NP_013687
SGD: S000004487
UniProt: P51998
Position
XIII:complement(join(224406..225239,225339..225365))
Genome map
AA seq 286 aa AA seqDB search
MTIKRNLVKTLQSIRYQATTATAHAESTLNPLPNAAIPPKYALVTVRSFPSLEPLTFVPV
PTSTVAAPLRRDILWRAVVYENDNRRVGASNPPGRSENGFSRRKLMPQKGSGRARVGDAN
SPTRHNGGRALARTAPNDYTTELPSKVYSMAFNNALSHQYKSGKLFVIGGEKVDLISPTP
ELDLNRLDLVNTNTVEGKEIFEGEVIFRKFLEEFQLKGKRLLFITDKTREGLIKSSDPYK
QKVDVIQKELVEVNDILRAQAVFIELEALEYLAMAHQKEILHSVSN
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgacgataaaaagaaatttggtgaaaactttacaatctatacgctaccaagctaccact
gccaccgcacatgcagaatccacgttaaaccctctgccaaacgcagccattcctcccaaa
tacgccttagttaccgttcgctcctttccatcattagaaccattgacatttgtgccggtc
cccacatcaactgtagctgctccattaaggcgtgatatactatggagagccgtagtttat
gaaaacgataatagaagagtaggcgcctcaaatcctcccgggagaagtgaaaacgggttt
tccagacgtaaattgatgccccaaaagggttctggtagggcaagagtcggggatgctaac
tctccaacaagacataatggtggtagggcattggcaagaactgcaccaaacgactatact
acagagctaccatccaaggtttattccatggctttcaacaacgctttgagccaccaatat
aaaagtggaaagttgtttgttattggtggtgaaaaggtcgacttaatatctcccacacca
gaactcgacttgaacaggctggatcttgtgaatacaaacacagttgagggcaaagagatt
tttgagggcgaagtcatcttcagaaaattcttggaggaatttcaacttaaaggtaagaga
ttacttttcattacagacaagactagggaagggctgataaagagttctgatccatacaaa
caaaaagtagatgttatacagaaagaacttgttgaggtaaatgacatactaagagcccaa
gctgtttttatcgaattggaagctcttgaatatctagcaatggcccatcagaaagaaatc
cttcactccgtgtctaactga

DBGET integrated database retrieval system