KEGG   Saccharomyces cerevisiae (budding yeast): YML028WHelp
Entry
YML028W           CDS       T00005                                 

Gene name
TSA1, TPX1, ZRG14
Definition
(RefSeq) thioredoxin peroxidase TSA1
  KO
K03386  peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC:1.11.1.15]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YML028W (TSA1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     YML028W (TSA1)
Exosome [BR:sce04147]
 Exosomal proteins
  Proteins found in most exosomes
   YML028W (TSA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC
Motif
Other DBs
NCBI-GeneID: 854980
NCBI-ProteinID: NP_013684
SGD: S000004490
UniProt: P34760
Structure
PDB: 

Position
XIII:220138..220728
Genome map
AA seq 196 aa AA seqDB search
MVAQVQKQAPTFKKTAVVDGVFDEVSLDKYKGKYVVLAFIPLAFTFVCPTEIIAFSEAAK
KFEEQGAQVLFASTDSEYSLLAWTNIPRKEGGLGPINIPLLADTNHSLSRDYGVLIEEEG
VALRGLFIIDPKGVIRHITINDLPVGRNVDEALRLVEAFQWTDKNGTVLPCNWTPGAATI
KPTVEDSKEYFEAANK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggtcgctcaagttcaaaagcaagctccaacttttaagaaaactgccgtcgtcgacggt
gtctttgacgaagtctccttggacaaatacaagggtaagtacgttgtcctagcctttatt
ccattggccttcactttcgtctgtccaaccgaaatcattgctttctcagaagctgctaag
aaattcgaagaacaaggcgctcaagttcttttcgcctccactgactccgaatactccctt
ttggcatggaccaatatcccaagaaaggaaggtggtttgggcccaatcaacattccattg
ttggctgacaccaaccactctttgtccagagactatggtgtcttgatcgaagaagaaggt
gtcgccttgagaggtttgttcatcatcgacccaaagggtgtcattagacacatcaccatt
aacgatttgccagtcggtagaaacgttgacgaagccttgagattggttgaagccttccaa
tggaccgacaagaacggtactgtcttgccatgtaactggactccaggtgctgctaccatc
aagccaaccgttgaagactccaaggaatacttcgaagctgccaacaaataa

DBGET integrated database retrieval system