KEGG   Saccharomyces cerevisiae (budding yeast): YML029WHelp
Entry
YML029W           CDS       T00005                                 

Gene name
USA1
Definition
(RefSeq) Usa1p
  KO
K14024  U1 SNP1-associating protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YML029W (USA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ubiquitin Rad60-SLD DUF2407 Rad60-SLD_2 GyrB_insert
Motif
Other DBs
NCBI-GeneID: 854979
NCBI-ProteinID: NP_013683
SGD: S000004491
UniProt: Q03714
Position
XIII:217362..219878
Genome map
AA seq 838 aa AA seqDB search
MSEYLAQTPCKFTIWSSEIDLIRTNLLVNAHPLSTVGRLLQYIHYQIYKQLRAIYQPEEQ
CTNSEIPHTPLNSINTYFLSYEGRELSATCLLKDITSSSHPDSNHFIRLQLEKRTSPSGS
AFDLEYDMEGEFNSMNIQFEINTLSSQRIFNSMEPNLPIGTTLARLEKLALERIKDFEKS
AGNLCGIKEDHSVSDLQGFIIKGKQTPMFLNYGSDSDYYKDLNLVDLIGIDFAPAHNSFF
TFLFKMNHEQNSHIANDEERFVLEFISDATLSITQMNVKPDTTVKQVKDFICSVYTHSLN
LRRNDIKLIYKGQLLHENNFAGNSSKISEYIKEPHEVKVHVQINQEYTESGPGFWNEVFN
NPNIFQFMPPDTRSQSPVSFAPTQGRSPAAIRGEERGIPYVTESGNDIVPTDELYRKCII
NGDEVVFIPVSELNPQSSYLSVIKGDYGEIKIPISSNDYRINGDNILLSPSAIEQLESAL
NFKIERPRDSTLLHPSGEHVRAADNTSSANDNNTVENDESAWNRRVVRPLRNSFPLLLVL
IRTFYLIGYNSLVPFFIILEFGSFLPWKYIILLSLLFIFRTVWNTQEVWNLWRDYLHLNE
IDEVKFSQIKEFINSNSLTLNFYKKCKDTQSAIDLLMIPNLHEQRLSVYSKYDIEYDTNT
PDVGQLNLLFIKVLSGEIPKDALDELFKEFFELYETTRNMNTLYPQDSLNELLLMIWKES
QKKDINTLPKYRRWFQTLCSQIAEHNVLDVVLRYIIPDPVNDRVITAVIKNFVLFWVTLL
PYVKEKLDDIVAQRARDREQPAPSAQQQENEDEALIIPDEEEPTATGAQPHLYIPDED
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatatctagctcagacgccctgcaaatttactatatggtcaagcgagattgat
cttatcagaacaaacctgttggtgaacgctcaccctttaagcacggttgggcgactactt
caatatatccattatcaaatatacaagcaattaagagctatctatcaaccagaggaacag
tgcacgaactcggaaatacctcacacacccttaaatagtatcaacacttacttcctaagt
tacgaaggcagagagttatctgcaacgtgtttattaaaggacatcacgtcatctagccac
ccagattcgaaccatttcataagactacaactggaaaagcgtacttctccttccggttca
gcatttgacttggaatatgatatggagggcgaatttaactcgatgaatattcaatttgag
ataaatacactatcttctcaacgtatattcaattccatggaaccaaatttgcctattggc
actacattggctagattagagaaactggcattggaacgtataaaggattttgaaaaatca
gcagggaatctctgtggtattaaagaggaccattcagtgtctgatttgcagggatttata
ataaaggggaaacagacacccatgtttttaaattatggaagtgattctgattactataaa
gacttgaacctggtagatttgataggcattgattttgccccggcacacaattcttttttc
acatttttgttcaagatgaatcacgaacagaattcacatatcgccaacgatgaagagaga
tttgtgttggaattcatatccgatgccacattatctataactcaaatgaatgttaagccc
gataccacggtaaaacaagtgaaagatttcatatgttctgtttacactcactcattaaac
ttgaggagaaatgatatcaagttgatttataagggacagttgcttcatgaaaataatttt
gcaggcaactcttcaaagatcagcgagtacattaaagagccacatgaagtgaaggtccat
gtacaaatcaaccaagagtatacagaatctgggcctggattttggaatgaagtgttcaac
aatccgaatattttccaattcatgcctccagatacaaggtcacagtcacctgttagtttc
gctccgacgcaaggacgatctcctgctgcaatacgtggcgaagaacggggtataccatac
gtaaccgaatctggaaatgacatcgtgcccacagatgagctttataggaaatgcattatc
aacggggatgaagtagtattcattcctgttagcgaactaaatccacaatcgagctatttg
tccgtgatcaaaggcgattacggtgaaattaaaatccccatatctagtaatgactacaga
attaatggcgataatattttgctatcaccatctgcgatagagcagttagaatctgctttg
aacttcaaaatcgagagaccacgggattcgacactcttgcatccgtctggtgagcatgtt
cgagctgcagataatacctcttcggcaaatgataataatacagttgagaatgacgagtca
gcgtggaatagaagggtagtgcgtcccttgagaaacagcttcccgctgctattggtattg
ataagaacattttacttaattggctataattcattggttcccttttttattattttggag
tttggaagcttccttccctggaaatatatcattttactaagcttgcttttcatttttagg
actgtttggaatacccaagaggtgtggaatttatggcgagactatctccacttgaatgaa
attgacgaagtcaagtttagccagatcaaggagttcatcaattccaattcattgacctta
aatttctacaagaaatgtaaggacactcaatccgctattgatttactgatgatacctaat
ctacatgagcaaaggctatcggtctattctaagtatgatattgagtacgacaccaacacc
cctgacgttggacaattgaatttgctatttatcaaggtgctatcgggtgagattcctaag
gacgcgctagatgagttgttcaaagagtttttcgaattgtatgaaacgacaagaaacatg
aacacactatatcctcaagactctttgaacgaattgctgctgatgatttggaaggagtcc
caaaagaaagacatcaatacgctacccaagtacagaagatggttccaaaccttgtgctcg
caaatagcggagcataacgtccttgatgtcgtactcagatacataattccagacccggta
aacgatagggtgataaccgctgtgataaagaacttcgtgctcttttgggttacactactc
ccctatgtgaaggagaagctggatgatattgttgcacagagagcaagggaccgtgagcaa
ccggctccatctgcccaacagcaggaaaacgaagatgaggccctcataatccctgacgag
gaagaacccaccgccacaggtgcgcaacctcatctctacattcctgatgaagactaa

DBGET integrated database retrieval system