KEGG   Saccharomyces cerevisiae (budding yeast): YML038C
Entry
YML038C           CDS       T00005                                 
Symbol
YMD8
Name
(RefSeq) Ymd8p
  KO
K15280  solute carrier family 35, member C2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YML038C (YMD8)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   YML038C (YMD8)
SSDB
Motif
Pfam: TPT UAA PUNUT EamA SLC35F TMEM234
Other DBs
NCBI-GeneID: 854970
NCBI-ProteinID: NP_013674
SGD: S000004502
UniProt: Q03697
Position
XIII:complement(202775..204103)
AA seq 442 aa
MNRTVFLAFVFGWYFCSIALSIYNRWMFDPKDGLGIGYPVLVTTFHQATLWLLSGIYIKL
RHKPVKNVLRKNNGFNWSFFLKFLLPTAVASAGDIGLSNVSFQYVPLTIYTIIKSSSIAF
VLLFGCIFKLEKFHWKLALSVIIMFVGVALMVFKPSDSTSTKNDQALVIFGSFLVLASSC
LSGLRWVYTQLMLRNNPIQTNTAAAVEESDGALFTENEDNVDNEPVVNLANNKMLENFGE
SKPHPIHTIHQLAPIMGITLLLTSLLVEKPFPGIFSSSIFRLDTSNGGVGTETTVLSIVR
GIVLLILPGFAVFLLTICEFSILEQTPVLTVSIVGIVKELLTVIFGIIILSERLSGFYNW
LGMLIIMADVCYYNYFRYKQDLLQKYHSVSTQDNRNELKGFQDFEQLGSKKIAPYSISVD
LTNQEYELDMIAQNVSRSSQQV
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgaataggactgtctttttggcatttgtatttggatggtatttctgttcaatagctctc
tccatatacaatagatggatgttcgatccgaaggacggattgggtattgggtatcccgtg
ttggtgacaacattccatcaggctactttatggttactatccggcatatacattaagctc
aggcataagccagtgaaaaacgttttaagaaagaataatggttttaactggagttttttt
ctaaaatttttactccctacggcagtcgcttctgcaggtgatatcgggctcagtaacgtt
tccttccagtatgttcccttgacaatttatacaattatcaaatcttcgagcatagctttt
gtccttttattcggctgtatcttcaagctagaaaagtttcattggaagttggcactttca
gtaataattatgtttgttggtgtagcattaatggttttcaaaccaagcgattccaccagt
accaaaaacgaccaagccttggtcatttttggcagctttcttgtcctagcaagtagctgt
ctttctgggttaaggtgggtttatacgcagttgatgcttaggaacaacccaattcaaact
aacaccgctgcagcagtagaggaatctgatggtgcccttttcacggaaaatgaagataat
gtcgataatgaacctgttgttaacctcgccaataacaaaatgctggagaattttggagaa
tccaagcctcacccaattcatacaatccaccagttagctcctataatgggcattactctg
ttgcttacctcgctacttgtggaaaaaccatttcctggtatattcagctctagcatattt
aggcttgatacgagcaatggcggtgtcggcacggaaactaccgtcctatccattgtgagg
ggtattgttttgttaattttacctggttttgcagtctttttgttgacaatttgtgagttt
agtattttggagcaaacgcccgtgctgaccgtatctattgtgggtatagtgaaggaactt
ttgacggtaatatttggtataattattctttctgaaagattaagtggtttttacaattgg
ttaggaatgcttattattatggcagatgtatgctattataattacttcagatataagcaa
gatctattacaaaaatatcattcagtttcgacacaagataatcgtaacgagttaaaggga
tttcaagacttcgaacagttaggaagcaagaaaatcgcaccatattctattagtgtcgac
ctaacaaatcaagagtatgagcttgatatgattgctcaaaacgttagtcgttcatcccag
caggtctga

DBGET integrated database retrieval system