KEGG   Saccharomyces cerevisiae (budding yeast): YML049C
Entry
YML049C           CDS       T00005                                 

Gene name
RSE1
Definition
(RefSeq) U2 snRNP complex subunit RSE1
  KO
K12830  splicing factor 3B subunit 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    YML049C (RSE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YML049C (RSE1)
   03041 Spliceosome [BR:sce03041]
    YML049C (RSE1)
   03036 Chromosome and associated proteins [BR:sce03036]
    YML049C (RSE1)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     YML049C (RSE1)
Spliceosome [BR:sce03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    YML049C (RSE1)
 Complex B
    YML049C (RSE1)
 Complex C
   U2 SnRNP specific factors
    YML049C (RSE1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    STAGA complex
     YML049C (RSE1)
    TFTC complex
     YML049C (RSE1)
SSDB
Motif
Pfam: MMS1_N CPSF_A
Other DBs
NCBI-GeneID: 854956
NCBI-ProteinID: NP_013663
SGD: S000004513
UniProt: Q04693
Structure
PDB: 
5ZWO 6G90 5LQW

Position
XIII:complement(174220..178305)
AA seq 1361 aa
MWGGGKMAVVSLSPHTAKMRKLFGQASTTMAYDGLKREAERRTRSDHNITMVAKDDELYL
YHLTLKKQTNFVHSCIGHFVDLEAGSKREQSQLCVATETHLELYDTADGELKLIAKFQNL
FATITSMKSLDLPHSGSRAKASNWPTFLALTSDSGNLSIVQIIMHAGALRLKTLVNQPLT
RTTLRRVSPISYMEIDPNGRCIILSSVEQNKLCFLVDYAQKLRISSPLEIIRPHMVTLDM
AVVDVNFNNPCFVTLEIDNAATQLSVHLIFYVLELGLNHIVKKADYLVNPSANFVLSLPD
LSRYNITTSLSDNNYDADYDTLFNPFVVIGFENHILVKDMNGFFSLKVEIPKRSITNSRH
KNVTIISGIVQKLKNDFFVLLQSNHGDLFKLTVSPDTNDRNRPLVQLSYFDTIQNSHQLH
IFKNGYLFALSEMNNNFLFQFEKLGVEKNDFSNVLTSKDPNKSLVFEPSIKLQNLSILSQ
QLNLNPSIKSQIVSDSPLSIATKHFTNNKIITLTNAVNYSNLISTSLPPNATKLWLIPDP
ATTGDNNTLLFITFPKKTMILQIDNESMEELTPDEATRSAFKLSQDTTIHTCLMGSHSII
QVCTAELRHIVPTGKSRYSNKLTWVPPAGIRIVCATSSKTQLIISLSNYELVYFKIDVSS
DSLIELTTHPELDTMPSKVAIVQDTQHADLLAIADNEGMIKIMSLKDQKEDFLTVISLQL
VSEKISDMIMVRDSSIGQLNLHVGLENGVYMKFHIGDVDGSFTDIKRRFLGLKPVSLSYL
REISVSLNNEEEEEEEEDDDDEKEEEEINSSGAKWMSCVVCHSSSTWVSYTWKNVWTIRQ
LKDQNMLSCSKFVNADVAINGVCSISSSGRLNIGRVSNFPTLDNWFHVHESSVNKQENGG
GDESNEEEEDEMEEEMEMLQISTFRPRTILSFPNNPKSILFIDNHSGKKQCRISLQIDGE
CLKFGSSDHLYKILDDIDCVSAAIIDFTRQADHLIICAGDKRLLTYKILVNKDKLSFDIE
LLHQTEIISPIHAMLKFKNFLLTAMGSTIVLYGLGKKQLLRRSVTQTPVSITKIVSMHQW
NYERLAVGDIHESVTLFIWDPAGNVFIPYVDDSVKRHVTVLKFLDEATVIGADRYGNAWT
LRSPPECEKIMSNHDPSELSNGAIKYPLDVITLQQKLPNTYDCKFKFQLLNHFFVNDIIT
DFHILDSLSNSDRPGCIYMGLQGTVGCFIPLLSKGNVFMMGNIENIMAEADDTFYLDYES
RKKNNNMRKEDDEEESGSVVLQGRHGIEDEIICEGSCSILGRDHQEYRSYYAPVRKVIDG
DLCENFLRLSLNEQEFLAKNLKSVQVEDIIQTINEVRTNYM
NT seq 4086 nt   +upstreamnt  +downstreamnt
atgtggggaggtggcaaaatggcagtagtaagcttgtcgccccacacggcgaagatgcgt
aaactatttgggcaagctagcacaacgatggcttatgacggtttaaaacgagaggctgaa
agaagaacaaggagtgaccataacataacaatggttgctaaagatgatgagctatacttg
taccatcttactttaaagaaacagacgaatttcgtgcactcctgcatcggacacttcgtc
gatctggaagcagggtccaagcgtgagcagtcgcaattgtgcgtagctactgagacgcat
ttagaactttatgatactgcagatggggaactaaagcttattgccaagtttcaaaacctg
tttgcgacgataacctcgatgaagtcgctggatctgccgcattcagggtcaagggcaaaa
gcttccaactggcccacttttctagcgctaacttccgattctggtaacctaagtatcgtg
caaatcattatgcatgcaggtgctcttagacttaagactttagtgaaccagccattgacg
aggaccacccttcgaagagtctctcccatatcatacatggaaattgaccctaatgggcgt
tgtatcattctctcatctgtcgaacaaaataaattgtgtttcctcgttgattatgctcaa
aaattgaggatttcgtctccattggaaatcatcagaccccatatggtaacgctggatatg
gcagttgttgatgtaaatttcaataatccatgttttgttaccttagaaatcgacaatgcc
gctactcaactatcagtacacttgatattttatgtcctcgagttgggtttgaatcacatc
gtcaagaaggcagattatttagttaacccatctgccaatttcgtactgagtttgccagat
ctatcgcgatataatataacaacttcgctaagcgacaacaactatgatgctgactatgat
acccttttcaacccttttgttgtcataggcttcgaaaatcatattctggtaaaggatatg
aacggatttttcagcctgaaagtggaaatacccaaaagatctatcacaaatagccgtcat
aaaaatgtaacaatcatatcaggcatagtgcagaaattgaaaaatgattttttcgtactt
ttacaatctaaccatggcgatctttttaagttaactgtaagtccagacactaatgataga
aatagacctttagttcaattgtcctactttgatacaatccaaaattcacaccaattacac
attttcaaaaacggttatctttttgcactatctgaaatgaataacaactttcttttccag
tttgagaaacttggtgtagagaaaaatgatttttctaatgttttaacctcaaaagatcca
aataagtcgctagttttcgaaccatccataaagttgcagaatttgagcatattatcgcaa
caattgaatttgaacccttcaataaaatctcaaattgtcagtgattcgccactgtctatc
gccactaaacattttacaaacaacaagataataactttaacaaatgctgtgaattactct
aatttgatatctactagtttacccccgaacgcaaccaagttatggctaatacccgatcct
gcaacaaccggcgataacaatactcttttgttcataacttttcccaagaaaactatgata
ctacaaattgacaacgagtccatggaggaactaacaccggatgaagcaacgcgttcagct
ttcaagctctctcaggacacaacaattcatacatgcctaatgggctcacactctattatc
caagtatgcaccgcagaactaagacatatcgtaccgactggtaaatctaggtattctaat
aagctgacttgggtgccaccagcgggaattcgtattgtatgtgccacgtcctcgaaaaca
caactaattatatcattatcaaattacgaattggtttatttcaagatagatgtatcttcg
gattcgttaatcgaattaaccacccacccagaattggacacaatgccctctaaagttgcg
attgtgcaagatacgcagcatgctgatttattagccattgctgacaatgagggtatgatc
aaaataatgtctcttaaagaccaaaaggaagattttttaactgtaataagtttgcaatta
gttagtgaaaagatttctgacatgataatggttagagattcctcaataggacagcttaat
ttgcatgtaggtttagaaaatggcgtttacatgaaatttcatataggggatgttgacgga
tcgttcactgacataaaaaggcgattccttggcttgaagcctgtttccctttcgtatttg
cgtgagatatctgtatcactaaataatgaggaagaagaagaagaagaagaagacgatgat
gatgaaaaagaagaagaagaaataaatagtagtggagctaaatggatgtcatgcgtggtt
tgccattcctcttctacatgggtaagctacacgtggaaaaatgtgtggaccatacggcag
ttaaaggatcaaaacatgctaagttgttccaaatttgttaacgcagatgttgcaatcaac
ggtgtttgttcaatatcgagctcaggacgcttaaatattggcagagtttccaactttcca
actttggataactggtttcacgttcatgaatcaagtgttaacaagcaagagaacggtgga
ggagatgaaagcaatgaagaggaagaagatgaaatggaagaagaaatggaaatgttacaa
atatctacattccgacctcgtactattttatcatttcccaataatccgaaaagcattttg
tttattgataatcacagtggtaagaaacaatgccgtatatcactgcaaattgatggtgaa
tgcttaaagtttggcagttcggatcatttatacaagatactggacgatatcgattgcgtt
tccgctgctataatagatttcacaagacaagctgatcatttgatcatttgtgctggcgac
aaaaggctgttaacatacaagatattagttaacaaagataaactatcttttgatattgaa
ttacttcaccaaacagaaatcatttcaccaatacatgctatgttgaagtttaaaaacttc
ttgctgacagccatgggctccactattgtcctttatggtttggggaaaaagcaattatta
agaaggtccgtaacacagaccccggtatccataacaaaaattgtgtctatgcaccagtgg
aattatgaaagactggccgttggtgatatacatgaatctgtcactttatttatctgggat
cctgcggggaatgtatttattccgtacgtagatgactctgtaaaacgccatgtgacggta
ttgaaatttctagatgaggcaactgttataggcgctgatagatatggaaatgcgtggact
ttaaggtctccaccagagtgcgaaaaaatcatgtcaaatcatgatcccagcgaattatct
aatggggccatcaagtacccactagacgtcatcactttacagcagaaattacccaatact
tatgattgcaagttcaagtttcaactactgaaccacttctttgttaatgatatcatcact
gatttccatatcctggacagcctttcaaattctgatagacctggttgtatctatatgggc
ttacaaggaaccgtgggatgctttatccccttattatccaaggggaatgtttttatgatg
ggaaacattgagaatataatggctgaggcggatgatacgttttatttagattatgaatca
agaaagaagaataacaatatgcgtaaggaagacgatgaagaggaatctggaagtgttgtg
ttacaaggacggcatggtatagaggatgaaataatatgtgagggttcctgttccatttta
ggtagagaccaccaagaatacagaagctattatgcccctgtacgtaaagttattgatggt
gatttatgtgaaaatttcctgagactttccttgaatgagcaggaatttttggccaaaaat
ttaaagagtgtacaagtggaggatataattcaaacaatcaacgaagtcagaacaaattac
atgtaa

DBGET integrated database retrieval system