KEGG   Saccharomyces cerevisiae (budding yeast): YML063W
Entry
YML063W           CDS       T00005                                 

Gene name
RPS1B, PLC2, RP10B
Definition
(RefSeq) ribosomal 40S subunit protein S1B
  KO
K02984  small subunit ribosomal protein S3Ae
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YML063W (RPS1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YML063W (RPS1B)
Ribosome [BR:sce03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    YML063W (RPS1B)
  Archaea
    YML063W (RPS1B)
SSDB
Motif
Pfam: Ribosomal_S3Ae DLP_helical Abhydro_lipase
Other DBs
NCBI-GeneID: 854939
NCBI-ProteinID: NP_013648
SGD: S000004528
UniProt: P23248
Position
XIII:146482..147249
AA seq 255 aa
MAVGKNKRLSRGKKGLKKKVVDPFTRKEWFDIKAPSTFENRNVGKTLVNKSTGLKNASDA
LKGRVVEVCLADLQGSEDHSFRKVKLRVDEVQGKNLLTNFHGMDFTTDKLRSMVRKWQTL
IEANVTVKTSDDYVLRIFAIAFTRKQANQVKRHSYAQSSHIRAIRKVISEILTREVQNST
LAQLTSKLIPEVINKEIENATKDIFPLQNIHVRKVKLLKQPKFDVGALMALHGEGSGEEK
GKKVSGFKDEVLETV
NT seq 768 nt   +upstreamnt  +downstreamnt
atggctgttggtaagaataagagactatccagaggtaagaagggtttgaagaagaaggtc
gttgacccatttaccagaaaggaatggttcgatattaaagccccatccacttttgaaaac
agaaatgttggtaagactttagttaacaagtccactggtttgaagaatgcttccgatgct
ttgaagggtagagttgtcgaagtttgtttggctgacttgcaaggttctgaagaccattct
ttcagaaaggtcaagttgagagtcgatgaagttcaaggtaagaacttgttgaccaacttc
cacggtatggacttcactaccgacaaattgagatcaatggtcagaaaatggcaaactttg
atcgaagctaatgttaccgttaagacttccgatgattacgttttgagaatctttgctatt
gccttcaccagaaagcaagctaaccaagttaagagacactcttacgctcaatcttcccac
atcagagctatcagaaaagttatttctgaaatcttgaccagagaagttcaaaactctact
ttggctcaattgacctccaaattgattccagaagttatcaacaaggaaatcgaaaatgct
accaaggacatcttcccactacaaaacatccacgttagaaaggttaagttattgaaacaa
ccaaagttcgacgttggtgctttgatggctttgcatggtgaaggttccggtgaagaaaag
ggtaagaaggtttctggtttcaaggatgaagtcttggaaactgtgtaa

DBGET integrated database retrieval system