KEGG   Saccharomyces cerevisiae (budding yeast): YML085C
Entry
YML085C           CDS       T00005                                 

Gene name
TUB1
Definition
(RefSeq) alpha-tubulin TUB1
  KO
K07374  tubulin alpha
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04145  Phagosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    YML085C (TUB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YML085C (TUB1)
   03036 Chromosome and associated proteins [BR:sce03036]
    YML085C (TUB1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sce04812]
    YML085C (TUB1)
   04147 Exosome [BR:sce04147]
    YML085C (TUB1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     YML085C (TUB1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     YML085C (TUB1)
Cytoskeleton proteins [BR:sce04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    YML085C (TUB1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YML085C (TUB1)
  Exosomal proteins of other body fluids (saliva and urine)
   YML085C (TUB1)
  Exosomal proteins of colorectal cancer cells
   YML085C (TUB1)
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Other DBs
NCBI-GeneID: 854889
NCBI-ProteinID: NP_013625
SGD: S000004550
UniProt: P09733
Structure
PDB: 
4U3J 4FFB 5W3F 5W3H 5W3J

Position
XIII:complement(join(97941..99259,99376..99400))
AA seq 447 aa
MREVISINVGQAGCQIGNACWELYSLEHGIKPDGHLEDGLSKPKGGEEGFSTFFHETGYG
KFVPRAIYVDLEPNVIDEVRNGPYKDLFHPEQLISGKEDAANNYARGHYTVGREILGDVL
DRIRKLADQCDGLQGFLFTHSLGGGTGSGLGSLLLEELSAEYGKKSKLEFAVYPAPQVST
SVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCKRNLDIPRPSFANLNNLIAQVVSSVT
ASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYSPVLSKSKAFHESNSVSEITNACFEPG
NQMVKCDPRDGKYMATCLLYRGDVVTRDVQRAVEQVKNKKTVQLVDWCPTGFKIGICYEP
PTATPNSQLATVDRAVCMLSNTTSIAEAWKRIDRKFDLMYAKRAFVHWYVGEGMEEGEFT
EAREDLAALERDYIEVGADSYAEEEEF
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgagagaagttattagtattaatgtcggtcaagctggttgtcagattggtaatgcctgt
tgggaattatattcccttgagcacggtattaagccggatggacatctagaagatggcctt
tcaaagccgaagggaggagaagagggtttctccacgtttttccatgaaaccggctacggt
aagttcgttccaagggctatttacgtggatttagagcccaacgttattgacgaagtccgt
aacggtccttacaaggacttgttccatccagaacagttgatcagtggtaaggaggacgcg
gctaataattatgcaagaggccattacaccgttggtagagaaattttgggcgatgttctg
gataggattagaaaactggcagaccaatgtgatgggttacaagggttcttgtttacccat
tctcttggtggtggtactggttccggtctagggtccttactgttggaagaactatccgct
gaatacggtaagaaatccaagctggaatttgccgtataccctgctccacaagtgtctact
tctgtggttgagccttacaacacagttttaactacacatactacattggaacatgcagat
tgtactttcatggtcgataatgaggctatttacgacatgtgcaaaagaaacttggatatc
ccaagaccaagctttgcaaacttaaacaacctaattgctcaagtggtatcatctgttaca
gcatcattgagattcgacggttcattaaatgtagatttgaacgaatttcaaaccaatttg
gttccatatccaagaattcatttccccttagtttcatattctccagtcttatccaaatca
aaggcattccatgagtccaactctgtgtcagaaattacaaacgcttgttttgaacctggt
aaccagatggtcaagtgtgatccaagagatggtaaatacatggctacttgtctgttatac
aggggtgatgtggtaacaagagatgttcaaagagctgtcgagcaggtgaaaaacaagaag
accgtccaattggttgattggtgtccaactggtttcaagatcggtatttgctacgaacct
ccaactgccacaccaaactcacaattggccactgtggatagggccgtctgtatgttgtca
aataccacatccattgctgaggcttggaagagaatcgatagaaaattcgatttaatgtat
gccaaacgtgctttcgtccactggtatgtcggtgaaggtatggaagaaggtgaattcacc
gaagctagagaagatttggctgctttagaaagagattacatcgaagtgggtgccgactca
tacgctgaggaagaggaattttaa

DBGET integrated database retrieval system