KEGG   Saccharomyces cerevisiae (budding yeast): YML098WHelp
Entry
YML098W           CDS       T00005                                 

Gene name
TAF13, FUN81, TAF19
Definition
(RefSeq) Taf13p
  KO
K03127  transcription initiation factor TFIID subunit 13
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    YML098W (TAF13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YML098W (TAF13)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     YML098W (TAF13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TFIID-18kDa TAF Histone CDC45
Motif
Other DBs
NCBI-GeneID: 854875
NCBI-ProteinID: NP_013611
SGD: S000004564
UniProt: P11747
Position
XIII:77267..77770
Genome map
AA seq 167 aa AA seqDB search
MSRKLKKTNLFNKDVSSLLYAYGDVPQPLQATVQCLDELVSGYLVDVCTNAFHTAQNSQR
NKLRLEDFKFALRKDPIKLGRAEELIATNKLITEAKKQFNETDNQNSLKRYREEDEEGDE
MEEDEDEQQVTDDDEEAAGRNSAKQSTDSKATKIRKQGPKNLKKTKK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgtctaggaagctgaaaaaaacgaatctgtttaacaaggatgtaagttccttgctttac
gcttacggcgatgtgccgcagccactacaagctactgtgcagtgtttggatgaattggta
tctggatatttggtggatgtttgtactaacgcattccatacagcccagaattctcagcgc
aataagctccgattggaagatttcaagtttgccctccgtaaagacccgataaagcttggg
agagcagaagaactgatagctactaataagttgattacggaagctaagaagcagttcaat
gagacagacaatcaaaattcattaaagaggtacagagaagaggatgaagagggtgacgag
atggaagaggatgaggatgagcagcaggtgacggatgatgatgaggaagcagcgggccgt
aatagcgctaaacaatcaacagattcgaaggcaacaaagattaggaagcaggggcctaaa
aacctcaagaaaacaaaaaaatga

DBGET integrated database retrieval system