KEGG   Saccharomyces cerevisiae (budding yeast): YML099CHelp
Entry
YML099C           CDS       T00005                                 

Gene name
ARG81, ARGR2
Definition
(RefSeq) Arg81p
  KO
K09246  arginine metabolism regulation protein II
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YML099C (ARG81)
Transcription factors [BR:sce03000]
 Eukaryotic Type
  Zinc finger
   Cys6 metabolic regulators in fungi
    YML099C (ARG81)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fungal_trans_2 Zn_clus
Motif
Other DBs
NCBI-GeneID: 854874
NCBI-ProteinID: NP_013610
SGD: S000004565
UniProt: P05085
Position
XIII:complement(74398..77040)
Genome map
AA seq 880 aa AA seqDB search
MGISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKP
MQFDPYGVPIPQNSPATTTNLSGSVDEPQYQRRNIDFVRYDEEYVYHEDMDDELTMLHTP
PIEKISDNKTWIIKKFGVFKGTDKIDKQYAPRKKRNRKRVAKSLESSASISLSSLPSSST
ISFPIRHIEDKLRNKGHVKTGILSANDGVPPTPNLLDYDWNNLNITGYEWISSELRDDAL
LSAVTLQGHHLGHTQPQEISLEENSNVVSGEEHVNAKEHGCAFEADNQGSSTLPNKAASA
NDKLYQQNLKLLFQKNSSNSEEPDPQALIDDVFVNIEPRSLPASDLNKITLAPPNEESRM
PKSMLELTSYSSDLPPELVDIIPKTDLTVHGLARFLLNHYFNNVADKMTVVVLEKNPWKT
LYFPRALMALGDLAGLGQSSNSRNALLNALLAVSCFHLQSKYPRNYKLQKYFLGLGIELR
NQASNFLRLCLNTKSSIPEKYKDVLTAILSMNSIDVVWGTMADCQDHLALCEDFVESRMK
LRPNISEKTKTLHRIFSFLKLIQDSTALDKVRAKEIVILPSEEDDNYKPLDTSNATTSSS
EPRVDVVQEGLFREALNENDGKIHIEFVKEPITNVSADSTPSSTTPPIFTNIATESYYNK
SDISKLVSKTDENIIGTDSLYGLPNSLILLFSDCVRIVRHNEYYNLTYLPVPRKFNELSL
NFEKRLLKWKSEWNFHQENSEGKSFINSTAEALYHHTMSFYFSLIIYYFTMARSLNCQFL
QNYVAKVLDHLNAMEELVDQKKVKIVPLIWQGFMAGCACTDENRQQEFRRWAAKLAESGV
GSYWGARQVMLEVWRRRKEDEPGDNWYSVYKDWEMNLMLS
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgggaatttccagcaagaatggccctaaaaaaatgggaagggcaaagacgtttactggg
tgttggacgtgcagaggaagaaaagttaagtgtgatcttcggcatccccactgccaacga
tgtgaaaagtctaatttgccttgtggcggttatgatatcaaactccggtggtctaagcct
atgcaatttgacccgtacggtgtcccaatcccacaaaattctcctgcaactactacgaac
ttatcaggtagtgtcgatgaaccacaataccaacgacggaacatcgattttgtgcgctat
gatgaagaatacgtgtatcatgaagatatggatgatgagctaacaatgctgcatactccc
ccaattgagaaaataagcgataacaagacgtggatcataaagaaatttggggtgtttaaa
ggaacagataagatcgacaagcagtacgctccaaggaagaagcgcaataggaaaagagtt
gccaaaagcttggagagctcagcttctatttcgttatcttctttaccatcttcttcaact
atttcctttccaattagacatattgaagacaagttgagaaataaagggcatgtaaagaca
ggtattctctctgctaatgatggtgttccaccaacaccaaatcttttagattatgactgg
aacaatctgaatataacaggttacgaatggatctcgagtgaactcagagatgatgcatta
ttgtcagcggtgaccttacagggacatcacttaggacacacacagccacaagaaatctca
ttagaggaaaactctaatgtcgtgagtggggaagagcatgtgaatgccaaagaacatgga
tgtgcctttgaggctgataatcaaggttcatcaactttacctaataaagcagccagtgcc
aatgataaactttaccagcaaaacttgaagttactcttccagaaaaactcttcgaacagt
gaggaaccagaccctcaagcattgatcgacgatgtgttcgtcaatattgaaccaagatct
ctgcccgcatctgatctgaataaaataactctagctcctccaaatgaagaatcacgcatg
cctaagtccatgttagaactcacatcctattccagtgacctaccacctgaattggtagat
attatacccaaaacagaccttaccgtacatggtttagcgagatttcttttaaatcattat
tttaataatgttgcagataaaatgacagtggtcgtgctcgaaaagaacccatggaaaaca
ttatacttccccagagccttgatggcattaggcgatttagcgggtttgggacaatcctcc
aactcgaggaatgcgttgttgaatgctcttcttgctgtctcttgcttccacttgcaaagc
aagtacccaaggaactacaaactacaaaaatactttctgggcctaggtatcgaattgaga
aatcaagcctcgaactttctaagattatgtttgaacacaaaatcaagcatacctgagaaa
tataaagacgtactaactgcgatcttatctatgaactctattgatgttgtatgggggacg
atggcagattgccaggatcacttggctctttgtgaagacttcgttgagtcaagaatgaaa
ctaagacctaatatttctgaaaagacaaaaaccttacacaggattttctcgtttctgaag
ttaattcaagatagcactgcgttggataaagtcagggcaaaggaaattgttattttacca
agtgaagaagatgataattacaaaccattagatacatctaacgctactaccagtagcagt
gagccaagagttgacgttgtgcaggaaggtttatttagagaggcactcaatgaaaatgac
ggcaaaatacatattgaattcgttaaggagcctatcacaaacgtatccgctgactctact
ccatcttcgaccactcctccaatttttaccaacatagcaacagaaagttactataataaa
tctgatatatctaagctagtatcgaagactgatgaaaacataattggtacagattcactc
tatggattgcctaattcattaatattactattttcagactgtgttaggatagtgagacat
aatgaatattataatttaacttacctacctgtaccccgaaaatttaatgaactctcgtta
aatttcgaaaaaagattattgaaatggaaatcagaatggaacttccatcaagaaaattcg
gagggaaaaagcttcataaactcaacggctgaagcactatatcaccatacaatgagcttt
tatttcagtttaattatttattattttacaatggcaagaagtttaaattgccaatttcta
caaaactatgttgccaaagtattagatcacttaaatgcaatggaagaattggtggatcaa
aaaaaagtgaaaattgtccctttaatttggcaaggtttcatggcaggatgtgcttgcaca
gatgaaaacagacagcaagagtttagaagatgggcagccaaattagctgaaagtggagtg
ggctcctattggggagccaggcaagtaatgttggaagtttggaggcgacggaaagaggat
gagccgggcgataattggtattctgtttataaagattgggaaatgaatctgatgctatca
taa

DBGET integrated database retrieval system