KEGG   Saccharomyces cerevisiae (budding yeast): YML124C
Entry
YML124C           CDS       T00005                                 

Gene name
TUB3
Definition
(RefSeq) alpha-tubulin TUB3
  KO
K07374  tubulin alpha
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04145  Phagosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    YML124C (TUB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YML124C (TUB3)
   03036 Chromosome and associated proteins [BR:sce03036]
    YML124C (TUB3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sce04812]
    YML124C (TUB3)
   04147 Exosome [BR:sce04147]
    YML124C (TUB3)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     YML124C (TUB3)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     YML124C (TUB3)
Cytoskeleton proteins [BR:sce04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    YML124C (TUB3)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YML124C (TUB3)
  Exosomal proteins of other body fluids (saliva and urine)
   YML124C (TUB3)
  Exosomal proteins of colorectal cancer cells
   YML124C (TUB3)
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Other DBs
NCBI-GeneID: 854915
NCBI-ProteinID: NP_013582
SGD: S000004593
UniProt: P09734
Position
XIII:complement(join(22048..23360,23659..23683))
AA seq 445 aa
MREVISINVGQAGCQIGNACWELYSLEHGIKEDGHLEDGLSKPKGGEEGFSTFFHETGYG
KFVPRAIYVDLEPNVIDEVRTGRFKELFHPEQLINGKEDAANNYARGHYTVGREIVDEVE
ERIRKMADQCDGLQGFLFTHSLGGGTGSGLGSLLLENLSYEYGKKSKLEFAVYPAPQLST
SVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDICKRNLGISRPSFSNLNGLIAQVISSVT
ASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKKRATHESNSVSEITNACFEPG
NQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDWCPTGFKIGICYEP
PSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEGMEEGEFT
EAREDLAALERDYIEVGADSYAEEF
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgagagaggtcattagtattaatgttggtcaagcaggttgtcaaataggtaatgcatgc
tgggaattgtactccctagagcatggcatcaaggaagacggccatttggaggatggcttg
tcaaaacctaagggaggtgaagaaggattttctacattcttccatgaaacggggtacgga
aaattcgtcccaagagcaatctacgtggatttagagcccaatgttatcgatgaagtacgt
acaggacgtttcaaggagcttttccatccagaacaattgattaacggtaaggaagatgcc
gccaataactacgcaagaggccattatacagtgggtagagaaatagtggatgaagttgaa
gaaagaattagaaagatggccgaccaatgtgacggtttacaagggttcttgttcacccac
tccctcggtggtggaactggttccggtttaggttccctgttattagaaaacttatcgtat
gaatacgggaagaaatccaaattggaattcgccgtttatcctgcgcctcaattgtctact
tccgtcgtggaaccttacaacacggttttaaccacgcataccaccctggaacacgcagac
tgtacgtttatggtcgataacgaagccatttacgatatatgcaagaggaacttgggaatt
tctagaccaagcttcagcaacttgaacgggttgattgcccaagtgatatcatctgttaca
gcctctttgaggttcgatggttcattaaacgtggatttgaacgaatttcagaccaacttg
gtaccatatccaagaattcatttccctttggtttcctacgcacccatcttgtccaagaag
agggccacccatgaatccaactccgtgtcagaaatcacaaacgcttgtttcgaaccgggc
aatcaaatggttaagtgtgacccaacaaaggggaagtacatggctaactgtttgttatac
agaggtgacgtggtgaccagagatgtccaaagagccgtcgaacaggtgaagaataaaaaa
acagtacaaatggtggattggtgtccaacaggatttaagattggtatttgttatgagcca
ccaagtgtgataccaagttccgaattagccaatgtggatagagctgtctgcatgctatcc
aacaccactgccatcgcggacgcttggaagagaatcgatcagaaattcgacctgatgtat
gccaaacgtgctttcgtccattggtatgtcggtgaaggtatggaagaaggtgagttcacc
gaagctagagaagatttagctgccttagaaagagattatattgaagtgggtgccgattct
tacgctgaggagttctaa

DBGET integrated database retrieval system