KEGG   Saccharomyces cerevisiae (budding yeast): YMR011W
Entry
YMR011W           CDS       T00005                                 
Symbol
HXT2
Name
(RefSeq) hexose transporter HXT2
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YMR011W (HXT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YMR011W (HXT2)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YMR011W (HXT2)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 855023
NCBI-ProteinID: NP_013724
SGD: S000004613
UniProt: P23585
Position
XIII:288079..289704
AA seq 541 aa
MSEFATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLC
LMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFG
GLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSP
TLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFM
IAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNA
SWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIV
NFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVM
IVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSA
IGFSYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYVEGVKPWKSGSWISKEKRVSE
E
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgtctgaattcgctactagccgcgttgaaagtggctctcaacaaacttctatccactct
actccgatagtgcagaaattagagacggatgaatctcctattcaaaccaaatctgaatac
actaacgctgaactcccagcaaagccaatcgccgcatattggactgttatctgtttatgt
ctaatgattgcatttggtgggtttgtctttggttgggatactggtaccatctctggtttt
gttaatcaaaccgatttcaaaagaagatttggtcaaatgaaatctgatggtacctattat
ctttcggacgtccggactggtttgatcgttggtatcttcaatattggttgtgcctttggt
gggttaaccttaggacgtctgggtgatatgtatggacgtagaattggtttgatgtgcgtc
gttctggtatacatcgttggtattgtgattcaaattgcttctagtgacaaatggtaccaa
tatttcattggtagaattatctctggtatgggtgtcggtggtattgctgtcctatctcca
actttgatttccgaaacagcaccaaaacacattagaggtacctgtgtttctttctatcag
ttaatgatcactctaggtattttcttaggttactgtaccaactatggtactaaagactac
tccaattcagttcaatggagagtgcctttgggtttgaactttgccttcgctattttcatg
atcgctggtatgctaatggttccagaatctccaagattcttagtcgaaaaaggcagatac
gaagacgctaaacgttctttggcaaaatctaacaaagtcaccattgaagatccaagtatt
gttgctgaaatggatacaattatggccaacgttgaaactgaaagattagccggtaacgct
tcttggggtgagttattctccaacaaaggtgctattttacctcgtgtgattatgggtatt
atgattcaatccttacaacaattaactggtaacaattacttcttctattatggtactact
attttcaacgccgtcggtatgaaagattctttccaaacttccatcgttttaggtatagtc
aacttcgcatccactttcgtggccttatacactgttgataaatttggtcgtcgtaagtgt
ctattgggtggttctgcttccatggccatttgttttgttatcttctctactgtcggtgtc
acaagcttatatccaaatggtaaagatcaaccatcttccaaggctgccggtaacgtcatg
attgtctttacctgtttattcattttcttcttcgctattagttgggccccaattgcctac
gttattgttgccgaatcctatcctttgcgtgtcaaaaatcgtgctatggctattgctgtt
ggtgccaactggatttggggtttcttgattggtttcttcactcccttcattacaagtgca
attggattttcatacgggtatgtcttcatgggctgtttggtattttcattcttctacgtg
tttttctttgtctgtgaaaccaagggcttaacattagaggaagttaatgaaatgtatgtt
gaaggtgtcaaaccatggaaatctggtagctggatctcaaaagaaaaaagagtttccgag
gaataa

DBGET integrated database retrieval system