KEGG   Saccharomyces cerevisiae (budding yeast): YMR017W
Entry
YMR017W           CDS       T00005                                 

Symbol
SPO20, DBI9
Name
(RefSeq) Spo20p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: gp45-slide_C
Other DBs
NCBI-GeneID: 855031
NCBI-ProteinID: NP_013730
SGD: S000004619
UniProt: Q04359
Position
XIII:307489..308682
AA seq 397 aa
MGFRKILASKSHHSRHHNQHHKNLKLQNHRYVLISNITGSHETKYLSPFRMDNCSGSRRR
DRLHVKLKSLRNKIHKQLHPNCRFDDATKTSDDKCVSYEVPERDGLATISLEEVFPKSNR
CQIPEENLGETDSVIHRDLGNFANENDYPQWRKVESQYNLENVQPEEDEIVDRLRSEIRS
TKLKSVKTTSRTLEKAIEARCTGKRVLQQLSCQSNQLTKIESNCDMLKIQSNVADRKIDE
LAHENRSLLALKSPNPFRKKREREKRDQIYNLKLKHRHLQQETMKRAQDSDKNLAINLSS
EYGRYGQGVERQRILRDAQKYQFEADEEDNQMEIDLYGNLEQIKAVSGDLKIMAHAFGRE
FEAQNTRMFDIENNVQQADNALQAKRYRLEKVIGKRW
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggggttcagaaaaatacttgctagcaaatcgcatcacagtcgccaccataatcagcac
cataagaacctgaagttgcaaaatcatcgctatgtacttatttccaatattacaggatcc
catgaaacaaaatatttatcacccttcaggatggacaattgttcaggaagcagaagacgt
gataggctacatgtgaagcttaaatccttgaggaataaaatccacaaacaacttcaccca
aactgtcggttcgatgacgccactaagactagtgatgataaatgcgtctcttatgaggtg
cccgaaagggatggccttgctactatttcgttagaagaggtttttccaaagtccaacagg
tgccaaatacctgaagaaaacttgggagaaacagatagcgttattcacagagatttggga
aattttgcaaatgagaatgactatccacagtggagaaaagttgaaagtcaatataactta
gagaatgtccagcctgaggaggatgaaatagttgatagactcaggtccgagattagaagc
actaaattaaaatctgtaaaaacgacaagcagaacacttgaaaaagctatagaggctcga
tgtactggaaagagagttcttcaacaactaagttgtcagagcaaccaactcaccaagatc
gagagcaattgtgacatgcttaaaattcaatctaacgtagccgaccgaaagattgacgaa
cttgcccatgaaaatagaagcctgcttgcattaaaatcacccaaccccttcaggaagaaa
agggagagagaaaagcgagaccagatctacaatttgaagttaaagcatcgtcacttacag
caagaaactatgaaaagagcccaagattctgacaaaaatttagccataaatctaagttct
gaatatggacggtatggccaaggggtggaaagacagcgtattcttagagatgcccagaag
tatcagtttgaagccgatgaagaagataaccaaatggaaatcgacttgtacggaaaccta
gaacaaataaaagcggtgagtggtgacttgaaaattatggctcacgcttttggcagagag
tttgaagcacaaaacactagaatgtttgacatcgagaacaatgtacagcaggcagataat
gctttacaggccaagcgatatagattggagaaagtgatcgggaaaagatggtga

DBGET integrated database retrieval system