KEGG   Saccharomyces cerevisiae (budding yeast): YMR032W
Entry
YMR032W           CDS       T00005                                 

Gene name
HOF1, CYK2
Definition
(RefSeq) formin-binding protein HOF1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: FCH SH3_1
Other DBs
NCBI-GeneID: 855048
NCBI-ProteinID: NP_013746
SGD: S000004635
UniProt: Q05080
Structure
PDB: 
4WPE

Position
XIII:335298..337307
AA seq 669 aa
MSYSYEACFWDPNDNGVNILLGHISQGIRSCDSMILFFKQRSELEKDYARRLGAITGKLD
KDIGTNMDYGKLNETFNVVLSVEKARAQSHSKQSEILFRQIYTDTKAFAANLQARYTTLS
GKIERLRMDKFNKKKGCEVLQKKLQDAQIRFRDLQLNENNMIGAKRVEHNKRELLKWESN
SQEYKVQLDVLKQEYKASQKFWIHEWAQLSCELQEMENARISFLQSKLQQFATSSMETYI
LEQTKMDMLTNHLNSFTAADEISTFSKENGTGRLKHKTSKGDMNSSANWAQMSSISTTSK
KTESYMDNIRKLSSQLKETENKRKLASIDKYEKPLPSPEVTMATQFRNSTPVIRNETKVV
ANPTLSLRSSPVQLQSNVDDSVLRQKPDKPRPIVGEEQLKPDEDSKNPDEKGLMVHKRNQ
SLSSPSESSSSNPTDFSHIKKRQSMESMTTSVSSMANSIDDSQRFAKSWNSSNRKRKSMS
HLQVPSSASSRSDDGGRTPNSAHNLNEDDYNTRRDTSTSTILFKPPVAVRGTSRGHTHRQ
SMIMQDSSNPIEDALYEMERIQSSSKPGTKTGNIMDERGVVRDRGITVTLPIVTSEGFPV
IEYAKAMYPLIGNEAPGLANFHKGDYLLITEIVNKDWYKGEVYDNDRIDRNHRIGLIPYN
FIQLLHQGL
NT seq 2010 nt   +upstreamnt  +downstreamnt
atgagctacagttatgaagcttgtttttgggacccaaacgacaatggtgtgaacatcctt
ctgggtcacatttctcagggaataagatcttgcgactcaatgatacttttctttaagcag
cgtagtgagcttgagaaggactatgccaggcggcttggagccatcacgggaaaactagac
aaagacattggaacaaacatggattatggaaagttgaatgaaacatttaatgtggtgctc
agtgttgagaaagctcgagcacaatcgcattccaagcaaagtgagattcttttcagacag
atttacacggatactaaggcatttgccgctaacttgcaagcaagatatactacattgagt
ggaaagattgaaaggttgcggatggacaagttcaacaagaaaaaggggtgtgaggtgttg
caaaagaaattacaggatgcccagattagattcagagacttgcaattgaacgagaataat
atgattggggccaagagagtagaacacaacaagagagaactattgaaatgggaatcgaac
tctcaggaatataaggttcaactagacgttcttaagcaagaatataaggcatcgcagaaa
ttctggatacacgagtgggcgcaattatcctgcgaactgcaagaaatggagaacgctaga
atatcctttttacaatcgaaattacaacagttcgcaacctcatcgatggaaacatatatt
ttagagcaaacaaaaatggacatgttaacaaatcatctgaactcattcacggcagcggat
gaaatatcgacgttttcaaaagaaaatggaactggtagactgaaacataagacttccaaa
ggtgacatgaattctagcgccaactgggctcaaatgagcagtatctccacgacaagtaaa
aaaaccgaatcgtatatggacaatataaggaaactatcttctcagctgaaggaaaccgaa
aataaaaggaaactagcttcaatagacaaatatgagaaaccattgccatctccagaagtc
accatggctacacaatttagaaattccacacccgtcatacgtaatgagacaaaagtggtt
gctaacccaacattatctttgaggtcttcacccgtccagttacagagcaatgtggatgac
tccgtgttaaggcagaaacctgataaaccaaggccgattgttggggaagaacaacttaaa
cctgatgaagattcgaaaaatcctgatgaaaaaggtctaatggtgcataaaagaaatcaa
tctctcagctcaccatcagaatcaagttcttctaatccaacggattttagccacatcaaa
aagagacaaagtatggaatctatgactacatccgtaagttcaatggccaatagtatagac
gactcacagagatttgccaaatcatggaactcgtcaaataggaaaagaaaatctatgagc
catttgcaagtaccctcatccgcttcttcgaggtcggatgatgggggaagaacgcctaac
tctgcgcacaacctcaatgaagatgattataacacgaggagagataccagtacaagcaca
attttgttcaaacctcctgtggcagtaagaggaacgtctagggggcacacgcatagacaa
tccatgataatgcaagattcaagtaatccaattgaagatgccttgtacgaaatggaaaga
atccaaagtagttctaaaccaggtacaaaaacaggaaacatcatggatgagagaggtgtg
gtcagggatagaggtattactgttaccttgcctattgtcaccagtgaaggttttccagtc
attgaatatgccaaggccatgtatccattgattggaaatgaggcacctggattagcgaat
ttccataagggcgactatctgctaattactgagattgttaataaagattggtataaaggt
gaagtttatgataatgaccgtatagatagaaatcataggataggattaattccctataat
ttcattcagctactgcatcaaggtctttga

DBGET integrated database retrieval system