KEGG   Saccharomyces cerevisiae (budding yeast): YMR036C
Entry
YMR036C           CDS       T00005                                 

Gene name
MIH1
Definition
(RefSeq) putative tyrosine protein phosphatase MIH1
  KO
K02555  M-phase inducer tyrosine phosphatase [EC:3.1.3.48]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YMR036C (MIH1)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YMR036C (MIH1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YMR036C (MIH1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     YMR036C (MIH1)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    YMR036C (MIH1)
SSDB
Motif
Pfam: Rhodanese
Other DBs
NCBI-GeneID: 855052
NCBI-ProteinID: NP_013750
SGD: S000004639
UniProt: P23748
Position
XIII:complement(341856..343520)
AA seq 554 aa
MNNIFHGTEDECANEDVLSFQKISLKSPFGKKKNIFRNVQTFFKSKSKHSNVDDDLINKE
NLAFDKSPLLTNHRSKEIDGPSPNIKQLGHRDELDENENENDDIVLSMHFASQTLQSPTR
NSSRRSLTNNRDNDLLSRIKYPGSPQRSSSFSRSRSLSRKPSMNSSSNSSRRVQRQDGKI
PRSSRKSSQKFSNITQNTLNFTSASSSPLAPNSVGVKCFESCLAKTQIPYYYDDRNSNDF
FPRISPETLKNILQNNMCESFYNSCRIIDCRFEYEYTGGHIINSVNIHSRDELEYEFIHK
VLHSDTSNNNTLPTLLIIHCEFSSHRGPSLASHLRNCDRIINQDHYPKLFYPDILILDGG
YKAVFDNFPELCYPRQYVGMNSQENLLNCEQEMDKFRRESKRFATKNNSFRKLASPSNPN
FFYRDSHQSSTTMASSALSFRFEPPPKLSLNHRRVSSGSSLNSSESTGDENFFPILSKSS
MSSNSNLSTSHMLLMDGLDTPSYFSFEDERGNHQQVSGDEEQDGDFTFVGSDREDLPRPA
RRSLFPSLETEDKK
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgaacaatatatttcatggaactgaagatgaatgtgccaatgaagacgttcttagtttc
caaaaaatttccttgaaaagtccctttggtaagaagaagaacatatttagaaatgttcag
accttctttaagtcaaaaagcaaacattcgaatgtcgacgatgatttaatcaataaagag
aatcttgcctttgataaatctccattgttaacaaatcacaggagtaaggaaattgatggt
ccttcaccgaatataaagcagcttggccatcgcgatgagttagatgaaaatgaaaatgaa
aatgatgatatagtcttaagcatgcattttgcttctcaaaccttacaaagtccaacaaga
aactcatcaagaagatctttgaccaataatagggataatgatcttttaagtagaatcaag
tatcctggcagtccccagaggtcgagctctttttcaaggtcaaggtccttgtcgagaaag
ccaagcatgaatagcagtagcaattcaagcaggagggtgcaacggcaagatgggaaaatt
ccgaggtcatcgagaaaaagttcacagaaattttctaacattactcagaatactttgaac
ttcacgtctgcgtcatccagtccactagctcctaattcggtaggggtgaaatgttttgaa
tcatgcctagccaaaacacagataccatattattatgacgatcgtaactcaaatgacttt
ttccctcgaatttctccagaaacgttgaaaaatattctgcagaataatatgtgcgagtca
ttttataattcatgtcgtattatagattgtcggtttgaatacgaatatactggcggccac
ataataaactccgttaacatacactcgagagatgagttagagtacgaatttatccataaa
gttttgcatagcgatactagcaacaacaacactctaccaactcttttaattatccattgc
gaatttagttcccaccggggaccttcattggcctctcatttgagaaattgtgatcgtata
ataaatcaggatcattatcccaaattattctatcccgacatattgatattggatggcgga
tacaaagctgtttttgacaattttcctgaactatgttatccacgtcagtacgtgggaatg
aactcacaagaaaatttgctgaattgtgaacaagaaatggataagtttaggagagaatct
aaaagatttgctactaaaaataattcttttagaaaactagcttccccttcaaatcctaac
ttcttttatagagatagccatcaatcttcaacaacaatggcatcttctgcactatcgttc
aggtttgagccgcctccgaagctgtcattaaaccacagaagagtctctagtggttcatca
ttaaattcaagtgagagtacaggcgacgaaaatttcttccccatcttaagtaagtcgtct
atgagtagtaacagtaacctaagcacttcacatatgctactaatggacggactggatacc
ccatcatattttagtttcgaagatgagagaggcaatcatcagcaagtaagtggagatgaa
gagcaagacggagattttactttcgttggttccgaccgagaagatttacccaggcccgca
agaagatcgttattcccttctctagagactgaagataaaaaatga

DBGET integrated database retrieval system