KEGG   Saccharomyces cerevisiae (budding yeast): YMR056C
Entry
YMR056C           CDS       T00005                                 

Gene name
AAC1
Definition
(RefSeq) ADP/ATP carrier protein AAC1
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sce03029]
    YMR056C (AAC1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YMR056C (AAC1)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    YMR056C (AAC1)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   YMR056C (AAC1)
SSDB
Motif
Pfam: Mito_carr Fuseless
Other DBs
NCBI-GeneID: 855078
NCBI-ProteinID: NP_013772
SGD: S000004660
UniProt: P04710
Position
XIII:complement(387315..388244)
AA seq 309 aa
MSHTETQTQQSHFGVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGI
LDCFKRTATHEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWFAG
NLFSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGL
YRGFVPSVLGIIVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWVITMGASTASYPLD
TVRRRMMMTSGQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFRGVAAAGVISLYDQLQ
LIMFGKKFK
NT seq 930 nt   +upstreamnt  +downstreamnt
atgtctcacacagaaacacagactcagcagtcacacttcggtgtggacttccttatgggc
ggcgtttctgctgccattgcgaagacgggtgccgctcccattgaacgggtgaaactgttg
atgcagaatcaagaagagatgcttaaacagggctcgttggatacacggtacaagggaatt
ttagattgcttcaagaggactgcgactcatgaaggtattgtgtcgttctggaggggtaac
accgccaatgttctccggtatttccccacgcaggcgctgaattttgccttcaaagacaaa
attaagtcgttgttgagttacgacagagagcgcgatgggtatgccaagtggtttgctgga
aatcttttctctggtggagcggctggtggtttgtcgcttctatttgtatattccttggac
tacgcaaggacgcggcttgcagcggatgctaggggttctaagtcaacctcgcaaagacag
tttaatggattgctagacgtgtataagaagacactgaaaacggacgggttgttgggtctg
taccgtgggtttgtgccctcagttctgggtatcattgtctacagaggtctgtactttggc
ttgtacgattctttcaagcctgtgctgttgacgggggctctagaggggtcctttgttgcc
tctttcctattaggttgggtcattaccatgggtgcttccactgcgtcgtatcccttggat
acggtaagaagaaggatgatgatgacttcgggccagaccatcaagtacgacggtgctctg
gactgtttgagaaagattgttcagaaagagggcgcgtattccttgttcaagggctgtggt
gccaacatatttagaggagtcgctgcagctggtgtcatctcattgtacgatcagttgcaa
ctcataatgtttggcaaaaaattcaagtga

DBGET integrated database retrieval system