KEGG   Saccharomyces cerevisiae (budding yeast): YMR062CHelp
Entry
YMR062C           CDS       T00005                                 

Gene name
ARG7, ECM40
Definition
(RefSeq) glutamate N-acetyltransferase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00220  Arginine biosynthesis
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01210  2-Oxocarboxylic acid metabolism
sce01230  Biosynthesis of amino acids
Module
sce_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    YMR062C (ARG7)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     YMR062C (ARG7)
    2.3.1.35  glutamate N-acetyltransferase
     YMR062C (ARG7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-GeneID: 855084
NCBI-ProteinID: NP_013778
SGD: S000004666
UniProt: Q04728
Position
XIII:complement(395054..396379)
Genome map
AA seq 441 aa AA seqDB search
MRISSTLLQRSKQLIDKYALYVPKTGSFPKGFEVGYTASGVKKNGSLDLGVILNTNKSRP
STAAAVFTTNKFKAAPVLTSKKVLETARGKNINAIVVNSGCANSVTGDLGMKDAQVMIDL
VNDKIGQKNSTLVMSTGVIGQRLQMDKISTGINKIFGEEKFGSDFNSWLNVAKSICTTDT
FPKLVTSRFKLPSGTEYTLTGMAKGAGMICPNMATLLGFIVTDLPIESKALQKMLTFATT
RSFNCISVDGDMSTNDTICMLANGAIDTKEINEDSKDFEQVKLQVTEFAQRLAQLVVRDG
EGSTKFVTVNVKNALHFEDAKIIAESISNSMLVKTALYGQDANWGRILCAIGYAKLNDLK
SLDVNKINVSFIATDNSEPRELKLVANGVPQLEIDETRASEILALNDLEVSVDLGTGDQA
AQFWTCDLSHEYVTINGDYRS
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagaatatcatcaacattgcttcaacgctcgaagcagcttatagataagtatgcatta
tacgtgcccaagacgggctcttttcctaaaggatttgaagtaggctacactgcatctgga
gtcaaaaaaaacgggagcctggacctgggtgtaatcttgaataccaataaatctcgtcct
tcaaccgcagcagctgttttcacgaccaataaattcaaagctgcgccagttttgacatcg
aaaaaagtccttgaaactgctcgtggtaaaaacatcaacgctattgtagtcaattccggt
tgtgctaactcggtcacaggtgatcttggtatgaaagatgcccaagtaatgattgatttg
gttaacgataaaattggtcaaaaaaattctaccctagtcatgtctacaggcgttattgga
caacgactacagatggacaagatcagcactggtatcaataaaatttttggagaagaaaag
ttcggcagtgattttaactcttggttgaacgtagccaaatcaatctgtactactgatact
ttcccaaaattagttacatctagattcaaattacctagtggtactgagtatactttgaca
ggtatggcaaagggcgcgggtatgatttgtccgaatatggctaccttattaggtttcata
gttacagatcttcctattgaaagcaaggcgttgcagaagatgctgactttcgctactacc
cgttcatttaattgtatatcggtggacggtgatatgagcaccaatgacacaatttgcatg
ttggccaacggtgctattgacaccaaagaaattaacgaagactctaaagattttgaacaa
gtaaaattgcaggtcacagaatttgctcagcgcttggcccagttagtcgttcgcgatggt
gaaggttcgacaaagtttgttactgttaacgttaaaaatgctttgcattttgaagacgcc
aaaataattgctgaatcaatctcaaactctatgttggtcaaaaccgcactatatgggcaa
gatgccaattggggaagaatattgtgcgcgatcgggtatgcaaagctgaatgacttaaaa
tctctagatgtcaacaaaattaatgttagctttattgctaccgacaattcagaacctcgt
gagctgaagcttgtcgctaatggtgtgccacaattggagatcgatgaaacaagggcttct
gaaatattggctttgaatgatttggaagtgtctgtcgacttgggaaccggtgatcaggca
gcacaattttggacttgtgatttatcacatgaatatgtaacaattaacggtgattaccgt
tcataa

DBGET integrated database retrieval system