KEGG   Saccharomyces cerevisiae (budding yeast): YMR067CHelp
Entry
YMR067C           CDS       T00005                                 

Gene name
UBX4, CUI1
Definition
(RefSeq) Ubx4p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TUG-UBL1 UBX VGLL4
Motif
Other DBs
NCBI-GeneID: 855089
NCBI-ProteinID: NP_013783
SGD: S000004671
UniProt: P54730
Position
XIII:complement(404323..405573)
Genome map
AA seq 416 aa AA seqDB search
MPMVTVKYNFQLFKCKVSLNSTLNDVLHQSIQFFQLHTSSNDWSLIHLDKPVPLDLPWRL
LNLPTGVNLELSKSSNFPVANKTNREDIPFNTIKIRFQIPGRDSVVKEMPSDQPIAPILR
QMSGAAGDDFKIQVFSKIIEFKTIKDENLTLENLGIQEPSSVRLIFNNTSHSEGISANSA
IHPKQTPPTMTNPETVASLPPHELHKPSVFLPSDEPLAVIKDQIEDEEDYELTVEQAKKY
QKMLSSKAGTLGGPILTKRLREQSANNLPKKNKAISECLLRVKFPDRSHIQIAFKPNEDM
RTVYNVVSQFLIDENMPFTLNQSHPFKPLAKDDKKLLDDLEFGSKTMLLFETNSNSNGPL
IKAHLLEDAQKITHETRTTPSVNTINKSNPQGPSDNATSIKKTLNRVPKWMKLSKK
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcctatggttaccgtgaagtataacttccaacttttcaaatgtaaagtttcgttgaat
tcaacactaaacgatgtgttacaccaatccatacaattctttcaactgcacacctcgtca
aacgactggtcattgatacatttggataaaccggtgccattagatttgccatggaggctt
ctaaacttaccaacgggtgtcaacttagaattatctaaaagtagtaattttccggtggcg
aataagaccaaccgcgaagatattccattcaatacgatcaaaatacggtttcaaatccca
ggaagagattccgtggttaaagaaatgccatctgaccaaccaattgcccctatcttgcga
cagatgagcggcgctgcgggagatgattttaagatccaggtcttttccaagataatagag
ttcaaaacaattaaggatgagaatttgactctcgaaaatttagggattcaggagccttcg
tcagttagattgatttttaataatacatctcattctgagggcattagcgctaatagcgct
attcacccaaaacaaactccccctacgatgacgaacccggaaacggttgcttcactacca
cctcacgaactacataaaccttctgtgtttttgccctcggatgagccattagcagttatc
aaggatcaaatcgaggatgaagaagattatgaattgacagtagaacaagccaagaaatac
caaaaaatgttatcatcgaaggctggtactttgggtggtcctattttgacaaagagactt
agagagcaatcagccaacaacttgccaaagaaaaataaggctatatctgagtgtttgctg
agagtcaagttccccgatagaagccatattcaaatagcattcaaacccaatgaagacatg
cgtacagtttataacgtcgtgtcgcagttcctgatcgatgagaacatgccttttacgtta
aaccaatctcatcctttcaaacccttggctaaagacgataagaagctactggatgacctg
gaatttggctctaaaacaatgctgctttttgaaacaaattcaaattctaatggcccatta
ataaaggctcatcttttggaagacgcacaaaaaatcacacacgaaacgaggacaacccca
tcagttaatacgataaataaatccaatccacagggcccttctgataacgctacaagtatc
aaaaagactttaaatagagtacctaaatggatgaaattaagtaaaaaataa

DBGET integrated database retrieval system