KEGG   Saccharomyces cerevisiae (budding yeast): YMR070WHelp
Entry
YMR070W           CDS       T00005                                 

Gene name
MOT3, ROX7
Definition
(RefSeq) Mot3p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-C2H2 zf-C2H2_4 DUF3720 zf-H2C2_2 DUF1907
Motif
Other DBs
NCBI-GeneID: 855092
NCBI-ProteinID: NP_013786
SGD: S000004674
UniProt: P54785
Position
XIII:409154..410626
Genome map
AA seq 490 aa AA seqDB search
MNADHHLQQQQQQRQQHQQQQHQQQQHQHQHQQQQHTILQNVSNTNNIGSDSLASQPFNT
TTVSSNKDDVMVNSGARELPMPLHQQQYIYPYYQYTSNNSNNNNVTAGNNMSASPIVHNN
SNNSNNSNISASDYTVANNSTSNNNNNNNNNNNNNNNIHPNQFTAAANMNSNAAAAAYYS
FPTANMPIPQQDQQYMFNPASYISHYYSAVNSNNNGNNAANNGSNNSSHSAPAPAPGPPH
HHHHHSNTHNNLNNGGAVNTNNAPQHHPTIITDQFQFQLQQNPSPNLNLNINPAQPLHLP
PGWKINTMPQPRPTTAPNHPPAPVPSSNPVASNLVPAPSSDHKYIHQCQFCEKSFKRKSW
LKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKKNNIIFNYNNSSSS
NNNNDNNNNNNSNSASGSGGAGAAAAAATAPENEDGNGYDTNIKTLINDGVLNKDDVKRV
LNNLIVSHNK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcggaccatcacctgcaacagcagcagcaacagcgacaacagcatcaacaacaa
cagcatcaacaacaacagcatcagcatcagcatcaacagcagcagcacacgatattacaa
aatgtgtcgaacactaacaatatcggcagcgattcgctggcgtcacagcctttcaacacg
actactgtttcctctaacaaggacgacgttatggtgaactctggggcaagagaacttcca
atgcccttacatcagcagcagtatatatacccttactatcagtatacaagtaataacagt
aacaacaataatgtgacggctggtaacaatatgtctgcgtcgccgattgtccataacaac
agcaacaacagcaacaacagcaatatttctgcttctgattacactgtcgcaaacaacagt
actagcaataataacaataataataataataacaacaataataacaataatattcaccca
aaccagtttactgcggccgcaaatatgaactcaaatgctgcagcggctgcttattactcc
ttccccactgcgaatatgccaataccgcaacaggatcaacaatatatgttcaatcctgct
tcatacataagccattactattcagcagttaacagcaataacaatggtaataacgccgct
aacaatggcagcaacaactcttctcactcagccccagccccggcccccggtccaccccat
caccatcaccatcatagtaatacacacaacaacctcaacaatggtggtgctgtaaataca
aacaacgctcctcagcaccatccaacgataataacggatcaatttcaattccaactacaa
caaaacccttctccaaatttgaatctcaatattaacccggcacaacctctgcatctacct
cctggttggaaaataaacactatgccgcaaccacgtcctacgacagcacctaaccatccc
cctgcgccggtgccttcttcgaaccctgtggcctcgaacttggttcctgccccatcatca
gaccataaatatatccatcaatgccaattttgtgagaagtctttcaaaagaaaatcatgg
ttgaaaaggcacctattgtcacactcgcaacaaagacattttctatgcccttggtgctta
agcaggcagaagagaaaagataatcttttacagcatatgaaactcaagcatacaaattat
ttattagacgaactcaagaaaaacaacatcatctttaactacaacaattcttcctcctct
aataataacaacgacaataataataataataacagcaatagcgctagcggcagtggcggt
gccggtgccgcggcggcagcagcaacagctcccgaaaatgaagatggaaacggttacgat
acaaacatcaagactttaatcaatgatggtgtactgaataaggacgacgttaaacgtgtt
ttgaataaccttattgttagtcacaacaaatag

DBGET integrated database retrieval system