KEGG   Saccharomyces cerevisiae (budding yeast): YMR072WHelp
Entry
YMR072W           CDS       T00005                                 

Gene name
ABF2
Definition
(RefSeq) DNA-binding protein ABF2
  KO
K11830  transcription factor A, mitochondrial
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sce03029]
    YMR072W (ABF2)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial transcription factors
    YMR072W (ABF2)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    YMR072W (ABF2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_box HMG_box_2 PilJ_C Protamine_like
Motif
Other DBs
NCBI-GeneID: 855094
NCBI-ProteinID: NP_013788
SGD: S000004676
UniProt: Q02486
Structure
PDB: 

Position
XIII:411569..412120
Genome map
AA seq 183 aa AA seqDB search
MNSYSLLTRSFHESSKPLFNLASTLLKASKRTQLRNELIKQGPKRPTSAYFLYLQDHRSQ
FVKENPTLRPAEISKIAGEKWQNLEADIKEKYISERKKLYSEYQKAKKEFDEKLPPKKPA
GPFIKYANEVRSQVFAQHPDKSQLDLMKIIGDKWQSLDQSIKDKYIQEYKKAIQEYNARY
PLN
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaacagttacagcctattaactagatctttccacgaatcttctaagccccttttcaat
ttggctagcaccttgttgaaggcttccaagagaacgcagcttagaaatgaattgataaaa
cagggtcctaaaaggcccacatctgcttatttcttatatttgcaagaccacagaagtcaa
ttcgttaaggaaaatccaaccttacgtcctgctgaaatcagcaagattgccggtgaaaag
tggcaaaatttagaggctgatataaaggaaaaatacatttctgaaagaaaaaagttgtat
tctgaataccaaaaggcgaagaaggagtttgacgaaaaacttcctccaaagaaaccagca
ggacccttcattaagtatgccaatgaagttcgttcgcaagtttttgcacaacatcctgac
aagtctcaattggatctaatgaaaattatcggagataaatggcaatccttggatcaaagc
attaaggacaaatacatacaagagtacaaaaaagctatccaagaatataatgctcgctac
cctctcaactag

DBGET integrated database retrieval system