KEGG   Saccharomyces cerevisiae (budding yeast): YMR073CHelp
Entry
YMR073C           CDS       T00005                                 

Gene name
IRC21
Definition
(RefSeq) Irc21p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyt-b5 Thymopoietin
Motif
Other DBs
NCBI-GeneID: 855095
NCBI-ProteinID: NP_013789
SGD: S000004677
UniProt: Q04772
Position
XIII:complement(412268..412873)
Genome map
AA seq 201 aa AA seqDB search
MSSDGMNRDVSNSKPNVRFAAPQRLSVAHPAISSPLHMPMSKSSRKPLVRTKIRLDPGHS
ALDWHSLTSNPANYYTKFVSLQLIQDLLDDPVFQKDNFKFSPSQLKNQLLVQKIPLYKIM
PPLRINRKIVKKHCKGEDELWCVINGKVYDISSYLKFHPGGTDILIKHRNSDDLITYFNK
YHQWVNYEKLLQVCFIGVVCE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgacggcatgaacagagatgtttcaaactcgaaaccaaatgtcagattcgct
gctcctcagcgactaagcgttgctcatcctgccatatcatccccgctgcatatgcccatg
tcgaagtcgtcaagaaagcctcttgtaagaaccaaaataagactagatcctgggcacagt
gctctggactggcactctctaacctccaatccagcgaattattatacaaaattcgtttcg
ctacagcttatccaggatttactcgatgatccggtatttcaaaaagataacttcaagttt
tcaccttcacaactgaagaaccaattgcttgtccaaaagatacccctttataaaataatg
ccacccttaagaataaacagaaaaatcgtaaagaagcattgtaaaggtgaggacgagtta
tggtgcgttataaacggcaaagtctatgacatttctagttatttgaagttccatccaggt
ggtacggacatcttaataaagcaccgtaatagtgacgatttgattacatattttaataag
tatcatcaatgggttaactatgaaaaattattacaggtttgtttcattggcgttgtatgc
gaataa

DBGET integrated database retrieval system