KEGG   Saccharomyces cerevisiae (budding yeast): YMR075WHelp
Entry
YMR075W           CDS       T00005                                 

Gene name
RCO1
Definition
(RefSeq) Rco1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHD PHF12_MRG_bd C1_1 LpxC Tcp10_C
Motif
Other DBs
NCBI-GeneID: 855097
NCBI-ProteinID: NP_013791
SGD: S000004680
UniProt: Q04779
Position
XIII:413982..416036
Genome map
AA seq 684 aa AA seqDB search
MDTSKKDTTRSPSHSNSSSPSSSSLSSSSSKEKKRPKRLSSQNVNYDLKRRKIITSEGIE
RSFKNEHSNLAVEDNIPEEEPKELLEKDSKGNIIKLNEPSTISEDSKVSVTGLPLNKGPS
EKIKRESLWNYRKNLGGQSNNSEMTLVPSKRFTQVPKNFQDLNRNDLKTFLTENMTEESN
IRSTIGWNGDIINRTRDREPESDRDNKKLSNIRTKIILSTNATYDSKSKLFGQNSIKSTS
NASEKIFRDKNNSTIDFENEDFCSACNQSGSFLCCDTCPKSFHFLCLDPPIDPNNLPKGD
WHCNECKFKIFINNSMATLKKIESNFIKQNNNVKIFAKLLFNIDSHNPKQFQLPNYIKET
FPAVKTGSRGQYSDENDKIPLTDRQLFNTSYGQSITKLDSYNPDTHIDSNSGKFLICYKC
NQTRLGSWSHPENSRLIMTCDYCQTPWHLDCVPRASFKNLGSKWKCPLHSPTKVYKKIHH
CQEDNSVNYKVWKKQRLINKKNQLYYEPLQKIGYQNNGNIQIIPTTSHTDYDFNQDFKIT
QIDENSIKYDFFDKIYKSKMVQKRKLFQFQESLIDKLVSNGSQNGNSEDNMVKDIASLIY
FQVSNNDKSSNNKSASKSNNLRKLWDLKELTNVVVPNELDSIQFNDFSSDEIKHLLYLKK
IIESKPKEELLKFLNIENPENQSE
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggacaccagcaagaaagatactactaggtcgccctcacattccaacagttcttctcct
tcatcttcttctctctcttcatcttcttccaaagagaaaaaacgtcctaagagactatcc
tcccagaatgtaaattacgatttgaaaaggagaaagatcatcacttctgaaggtatagaa
agatcattcaagaacgagcatagcaatcttgcagttgaagacaatatcccggaagaagaa
cccaaggaacttcttgaaaaggactccaagggtaatatcatcaaacttaatgagccatcc
accatctcggaagattcgaaggtatctgtcactggattgccgttaaataaaggtccttct
gagaaaatcaagcgagagtctctttggaattatagaaaaaatttgggaggccaatcgaac
aactcagaaatgacgctggtccccagtaaaagatttactcaggtgccgaaaaattttcag
gatttgaacagaaatgatttgaaaacgtttttaactgagaacatgactgaagagagcaat
atacggtcaactattggttggaatggcgatataataaacagaactcgtgaccgtgaacct
gaaagcgaccgcgataataaaaagctatcaaatattagaaccaaaataatactttcaacg
aatgctacctatgattcaaaaagtaaactatttggccaaaattccatcaagtcaacatcg
aatgcgagtgaaaaaattttcagggacaagaacaattcaaccatagattttgagaatgaa
gatttttgttcggcttgtaatcagtcaggttcttttttatgctgtgatacatgccccaaa
tcctttcactttctttgcttagacccaccaattgatccgaacaacctgcctaaaggtgat
tggcattgtaatgaatgtaagtttaaaatcttcataaataactcaatggcaactttaaaa
aaaattgaatccaacttcattaagcaaaataacaacgtcaagatttttgctaaattactt
ttcaatatcgattcccacaacccaaaacagttccagctaccaaattatataaaagaaacc
tttcctgctgtgaaaacgggttcgagaggacaatactctgatgagaatgataagattcca
ttaactgatagacaattgtttaacacttcttatggccaaagcataactaaattggactct
tacaacccggatacacatatagattcaaattcaggtaagtttttaatttgttacaaatgc
aatcaaaccagactaggttcatggtctcatccagaaaattcaagattaataatgacttgt
gattattgtcagactccatggcatttggattgtgtaccgagggcttctttcaagaactta
ggttcaaaatggaaatgtcctctacattccccaactaaagtttacaaaaagatacaccat
tgtcaagaagataatagcgtaaattataaggtgtggaaaaaacaacgattgataaacaag
aaaaaccaactttattatgaacctttacaaaaaataggctaccaaaataacgggaacatt
caaatcataccaacaactagtcatacagattatgatttcaatcaagatttcaaaattaca
caaatagatgaaaattccattaaatatgatttttttgataaaatttacaaatcaaaaatg
gttcaaaaaagaaaactctttcaatttcaagaaagtttaatagataagttagtatcaaat
ggatcccaaaatggcaatagcgaggataatatggtcaaagacatagcctctttaatatat
ttccaagttagcaacaacgacaagagtagtaacaataaatcggcttccaaaagcaataac
ttaagaaaattatgggatttgaaagaactgactaacgtagtcgtgccgaacgaactagat
tctatacaattcaatgacttttccagcgatgaaataaagcatctgttatatttaaagaag
attatcgaatccaaaccaaaggaagaactgttaaaatttttaaacatagaaaatcccgaa
aaccaatccgaatag

DBGET integrated database retrieval system