KEGG   Saccharomyces cerevisiae (budding yeast): YMR077CHelp
Entry
YMR077C           CDS       T00005                                 

Gene name
VPS20, CHM6, VPL10, VPT20
Definition
(RefSeq) ESCRT-III subunit protein VPS20
  KO
K12195  charged multivesicular body protein 6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04144  Endocytosis
Module
sce_M00412  ESCRT-III complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YMR077C (VPS20)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YMR077C (VPS20)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YMR077C (VPS20)
Membrane trafficking [BR:sce04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    YMR077C (VPS20)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YMR077C (VPS20)
  Exosomal proteins of other body fluids (saliva and urine)
   YMR077C (VPS20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Snf7 SlyX Mating_N UvrD-helicase DUF948
Motif
Other DBs
NCBI-GeneID: 855101
NCBI-ProteinID: NP_013794
SGD: S000004682
UniProt: Q04272
Structure
PDB: 

Position
XIII:complement(421484..422149)
Genome map
AA seq 221 aa AA seqDB search
MGQKSSKVHITKTDRAILEVKRSKDEIHKFTRRTDNLILVEKSQLKDLIRKNPENYKSNM
KVRFLLKRIHYQEHLLQQASDQLINLENMVSTLEFKMVEKQFINGLKNGNEILKKLNKEF
SNVDELMDDVQDQIAYQNEINETLSRSLVGTSNYEDDLDKELDALESELNPEKMNNAKVA
NMPSTEGLPSLPQGEQTEQKEREEFATEERSDTKEPLALLS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgggccaaaaaagtagtaaagtgcatataaccaaaacagatagggcgatcctagaagta
aaacgatctaaagatgaaattcataagtttacgaggaggacagataatttgattttggta
gagaagagtcaactaaaagacctaatacgaaaaaatcctgaaaattataaatctaacatg
aaggtacgatttctactaaaaagaattcattatcaggagcatttgttgcagcaggcttcg
gatcagcttattaatttggaaaatatggtgtcaacacttgagttcaaaatggtagaaaag
caatttattaatggactgaaaaatggaaatgaaatcttgaaaaaactaaacaaggaattt
agcaatgttgatgaactgatggacgatgtacaagatcaaattgcgtatcaaaatgaaatt
aacgagacattatctagaagcttagtcggaacaagcaattatgaagacgatctagataag
gaattggatgctctagaaagtgaactcaatccagagaagatgaataacgcaaaagtagct
aacatgccatcaacagaaggtttgccatcattgcctcaaggagaacaaaccgagcaaaaa
gaaagagaggaattcgcgacggaggagagatcagacactaaggaacctttagcattacta
tcctga

DBGET integrated database retrieval system