KEGG   Saccharomyces cerevisiae (budding yeast): YMR078CHelp
Entry
YMR078C           CDS       T00005                                 

Gene name
CTF18, CHL12
Definition
(RefSeq) Ctf18p
  KO
K11269  chromosome transmission fidelity protein 18
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YMR078C (CTF18)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    YMR078C (CTF18)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA Rad17 RuvB_N AAA_16 AAA_assoc_2 AAA_14 AAA_22 AAA_33 RNA_helicase AAA_11 AAA_5 AAA_18 Arch_flagellin IPT Phage_Mu_Gam
Motif
Other DBs
NCBI-GeneID: 855102
NCBI-ProteinID: NP_013795
SGD: S000004683
UniProt: P49956
Structure
PDB: 

Position
XIII:complement(422503..424728)
Genome map
AA seq 741 aa AA seqDB search
MVDTAPYIGSLGRSSLFDTGDIEQAPGNNAIGINEEDIHAFVSSTGETVQLKKKPAKLAT
GNISLYTNPDTVWRSDDTYGININYLLDKIEASGDDRTNAQKTSPITGKIGSDTLWVEKW
RPKKFLDLVGNEKTNRRMLGWLRQWTPAVFKEQLPKLPTEKEVSDMELDPLKRPPKKILL
LHGPPGIGKTSVAHVIAKQSGFSVSEINASDERAGPMVKEKIYNLLFNHTFDTNPVCLVA
DEIDGSIESGFIRILVDIMQSDIKATNKLLYGQPDKKDKKRKKKRSKLLTRPIICICNNL
YAPSLEKLKPFCEIIAVKRPSDTTLLERLNLICHKENMNIPIKAINDLIDLAQGDVRNCI
NNLQFLASNVDSRDSSASDKPACAKNTWASSNKDSPISWFKIVNQLFRKDPHRDIKEQFY
ELLNQVELNGNSDRILQGCFNIFPYVKYSDNGIRKPANISDWLFFHDLMYQSMYAHNGEL
LRYSALVPLVFFQTFGDIANKDDIRMKNSEYEQRELKRANSDIVSLIMRHISVQSPLMAS
FTDRKSLIFEILPYLDSMISSDFNKIRNLKLKQAIMEELVQLLKSFQLNLIQNRSEGFDV
RGGLTIDPPIDEVVLLNPKHINEVQHKRANNLSSLLAKIEENRAKKRHIDQVTEDRLQSQ
EMHSKKVKTGLNSSSSTIDFFKNQYGLLKQTQELEETQKTIGSDETNQADDCNQTVKIWV
KYNEGFSNAVRKNVTWNNLWE
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggttgataccgcaccatacattggttcactagggagaagttccctttttgatactggt
gatatagaacaagcccctggtaataatgcaattggtattaatgaggaagatattcacgcg
tttgtatcaagtactggcgaaacggttcaattaaagaagaagcctgcgaagttagcaacc
gggaatattagtctatacactaacccagatactgtttggagatcagacgacacgtacggc
atcaatataaactatttgttagacaaaattgaggcatctggcgatgaccgcactaacgca
caaaagacttcacctataactggcaagataggtagcgacacactctgggtagagaaatgg
cgtcctaaaaaatttctagatttggttggtaatgaaaagacaaacaggagaatgttaggt
tggttgagacaatggacgccggctgtgtttaaagagcaattacccaaattgccaaccgaa
aaagaggtcagtgatatggaactcgatccattgaaaaggccaccaaagaaaattttacta
ctgcacgggccaccaggaataggcaaaacctcagtagctcacgttattgccaaacaatca
gggttttctgtctcagaaatcaatgcaagtgatgaaagggctggacctatggtaaaagag
aaaatatataatcttttattcaatcatactttcgatacaaatcctgtgtgcttagtggcg
gatgagattgatggaagtattgagagtggatttattagaattttagttgacattatgcaa
agcgatattaaagccactaataaactattatacggtcaaccagataaaaaggacaaaaag
cgcaaaaagaaaaggtctaaattgcttacgcgacctattatttgtatttgcaataatcta
tatgctccttctttggaaaagctgaaaccattctgtgaaattattgctgtgaaaagacct
tccgatactaccctactagagcgattgaaccttatctgccataaagaaaacatgaatatt
cctataaaagcaatcaatgacttaattgatttggctcaaggtgacgtaaggaattgtata
aacaatttacaattcttggcctcgaatgttgattcaagagattcctctgcatcagataaa
cctgcttgtgcaaaaaatacgtgggcgtcatccaacaaggactcccccatatcatggttt
aaaatcgtgaaccaattgtttagaaaggatccacatcgtgatataaaggagcagttttat
gaattgctaaaccaagtagagcttaatggtaactctgacaggatattgcaaggctgtttt
aatatatttccctacgtaaaatattccgacaatggtataagaaagccagcaaacatttca
gattggctatttttccatgatttaatgtaccaatcaatgtatgcgcataatggcgaattg
ttacgttactccgcccttgtgcccctagtcttcttccaaacgtttggcgatatcgcaaac
aaagatgatattagaatgaagaatagtgaatacgaacaacgtgaattaaaacgagccaat
tcagatatagttagtctgattatgagacatatctcggttcagtccccactaatggcaagt
tttacggatagaaaatcgttaatctttgaaatactaccatatctagattcgatgatctct
tccgattttaataaaataaggaacctgaaactcaaacaagccatcatggaggaattagtt
caattgctgaaaagctttcaactgaatctaatccaaaatcggtcagaaggatttgatgta
aggggtggcctaacaatcgatcccccaatcgatgaagtcgtattgttaaatcctaaacat
attaacgaagtccaacataaacgggctaataatttgagttcactgttagcaaagattgag
gaaaaccgggccaagaaaaggcatatagaccaagtgactgaggatagactacagtcacag
gaaatgcatagcaaaaaagtcaaaactgggttaaattcttcctcaagtacaatcgacttt
ttcaagaatcagtacggattattgaagcaaactcaggaattggaagagacacaaaaaact
attggatcagacgaaaccaaccaagcagatgactgcaatcaaacggttaaaatatgggtg
aaatacaatgaggggttctctaacgctgtcaggaaaaatgtgacttggaataacctgtgg
gaataa

DBGET integrated database retrieval system