KEGG   Saccharomyces cerevisiae (budding yeast): YMR079WHelp
Entry
YMR079W           CDS       T00005                                 

Gene name
SEC14, PIT1
Definition
(RefSeq) phosphatidylinositol/phosphatidylcholine transfer protein SEC14
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CRAL_TRIO CRAL_TRIO_N CRAL_TRIO_2 DUF1769
Motif
Other DBs
NCBI-GeneID: 855103
NCBI-ProteinID: NP_013796
SGD: S000004684
UniProt: P24280
Structure
PDB: 

Position
XIII:join(424989..424997,425154..426059)
Genome map
AA seq 304 aa AA seqDB search
MVTQQEKEFLESYPQNCPPDALPGTPGNLDSAQEKALAELRKLLEDAGFIERLDDSTLLR
FLRARKFDVQLAKEMFENCEKWRKDYGTDTILQDFHYDEKPLIAKFYPQYYHKTDKDGRP
VYFEELGAVNLHEMNKVTSEERMLKNLVWEYESVVQYRLPACSRAAGHLVETSCTIMDLK
GISISSAYSVMSYVREASYISQNYYPERMGKFYIINAPFGFSTAFRLFKPFLDPVTVSKI
FILGSSYQKELLKQIPAENLPVKFGGKSEVDESKGGLYLSDIGPWRDPKYIGPEGEAPEA
FSMK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggttacacaacaagaaaaggaatttttagaatcctaccctcaaaactgtcctccagat
gccttgcctggtactccaggaaatttagacagcgctcaagagaaggcattggcagaacta
agaaaacttttggaagacgctggtttcattgaacgtttagacgattcaactttactacgt
tttttgagagccagaaaatttgatgttcaattggctaaagaaatgtttgaaaactgcgaa
aaatggaggaaggattatggtaccgacactatcttgcaagattttcattatgatgaaaaa
ccattgattgccaaattctacccacaatattatcataaaaccgataaagatggccgccca
gtatattttgaagaattaggtgctgttaacttacatgaaatgaacaaggttacctctgaa
gagaggatgttgaaaaacttggtttgggaatacgaatctgtcgttcaatacagattacct
gcctgttcaagagctgctggtcacctagtggaaacttcatgtacaattatggatttgaaa
ggtatctccatatctagtgcatacagtgttatgtcatatgttagggaagcctcctacata
agtcaaaactattaccccgaacgtatgggtaaattttacatcatcaacgcgccattcggt
ttctctaccgcatttaggctatttaaacctttcttggatccagtcactgtttcaaagatt
tttatcttgggttcttcttaccagaaggaattattaaagcaaattccagctgaaaactta
ccagtcaaatttggcggtaagtctgaagttgatgaatccaagggtgggttatacctatcc
gatatcggtccatggagggatccaaagtatattggaccggaaggtgaagctccggaagcc
ttttcgatgaaatga

DBGET integrated database retrieval system