KEGG   Saccharomyces cerevisiae (budding yeast): YMR092C
Entry
YMR092C           CDS       T00005                                 

Gene name
AIP1
Definition
(RefSeq) Aip1p
  KO
K24736  WD repeat-containing protein 1 (actin-interacting protein 1)
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sce04990]
    YMR092C (AIP1)
Domain-containing proteins not elsewhere classified [BR:sce04990]
 WD40 repeat (WDR) domain-containing proteins
  Other WDR domain-containing proteins
   YMR092C (AIP1)
SSDB
Motif
Pfam: WD40 RAB3GAP2_N Nup160 CDKN3
Other DBs
NCBI-GeneID: 855117
NCBI-ProteinID: NP_013810
SGD: S000004698
UniProt: P46680
Structure
PDB: 
1PGU 1PI6

Position
XIII:complement(451632..453479)
AA seq 615 aa
MSSISLKEIIPPQPSTQRNFTTHLSYDPTTNAIAYPCGKSAFVRCLDDGDSKVPPVVQFT
GHGSSVVTTVKFSPIKGSQYLCSGDESGKVIVWGWTFDKESNSVEVNVKSEFQVLAGPIS
DISWDFEGRRLCVVGEGRDNFGVFISWDSGNSLGEVSGHSQRINACHLKQSRPMRSMTVG
DDGSVVFYQGPPFKFSASDRTHHKQGSFVRDVEFSPDSGEFVITVGSDRKISCFDGKSGE
FLKYIEDDQEPVQGGIFALSWLDSQKFATVGADATIRVWDVTTSKCVQKWTLDKQQLGNQ
QVGVVATGNGRIISLSLDGTLNFYELGHDEVLKTISGHNKGITALTVNPLISGSYDGRIM
EWSSSSMHQDHSNLIVSLDNSKAQEYSSISWDDTLKVNGITKHEFGSQPKVASANNDGFT
AVLTNDDDLLILQSFTGDIIKSVRLNSPGSAVSLSQNYVAVGLEEGNTIQVFKLSDLEVS
FDLKTPLRAKPSYISISPSETYIAAGDVMGKILLYDLQSREVKTSRWAFHTSKINAISWK
PAEKGANEEEIEEDLVATGSLDTNIFIYSVKRPMKIIKALNAHKDGVNNLLWETPSTLVS
SGADACIKRWNVVLE
NT seq 1848 nt   +upstreamnt  +downstreamnt
atgtcatctatctctttgaaggaaattataccacctcagccttcgacacagcgtaacttt
actacgcatttatcgtatgaccctacaaccaacgcaattgcttacccatgtggaaaatct
gcatttgtacgttgtttggacgatggagacagtaaagtacctccagtagtacaatttact
ggtcatggctcttcggtagtcacaacggtaaagttctctccaattaagggttcccagtac
ctatgctccggtgacgaatctggaaaagtgattgtttggggatggacatttgacaaagaa
agcaattctgttgaagtgaatgttaagtctgaattccaagttttagcaggtccaatcagc
gatatctcctgggattttgaagggcgaagactctgcgttgtgggagaaggtcgtgataac
tttggtgttttcatatcctgggattctggtaattccttaggtgaagtttcaggtcactca
caacgcatcaatgcttgtcatttgaagcaatctagacctatgagatctatgacagttgga
gatgatggatctgttgtcttttatcaaggacctccatttaagttctctgccagtgacaga
acacaccacaaacaaggctcatttgtcagggatgttgaattttcacctgacagcggtgaa
tttgttattacggtagggtctgacagaaagatttcttgctttgatggcaaatcaggtgag
tttcttaaatacatagaggatgatcaagaaccagttcaaggtggtatatttgcactatcg
tggcttgattcccaaaagtttgctaccgtaggagcagacgctaccattagggtttgggac
gtcacgacttcaaaatgcgttcaaaaatggaccttagacaagcaacaactgggaaatcaa
caagttggtgttgttgcaacaggaaacggaaggattatttctctttcactggatgggacc
ttaaacttctatgaacttggacatgacgaggttttaaaaaccattagtggtcataacaag
ggtattactgctttgacagtcaacccactaatcagtgggtcatatgatggtaggattatg
gaatggtctagctcttccatgcaccaagatcactccaacttgattgtatcattggataat
agtaaagcgcaagaatactccagtatttcttgggatgatactttgaaagtgaacggtatt
actaagcatgaatttggatcgcaaccaaaggttgctagtgcgaacaatgatggcttcact
gcagtactaacaaatgatgatgatttgttgatattacagtcttttacgggcgatataatc
aagagtgtaagactgaactcaccaggctctgccgttagcttgagccaaaattacgttgca
gttggtttggaagaaggtaatactattcaggtattcaaattatcagatttggaagtcagt
tttgatttaaaaacacctcttcgcgcaaaaccctcgtacatatcaatttcgccatctgaa
acatacatcgctgctggagatgttatgggcaagatattgctatatgatttacaatcaaga
gaagtgaaaacttcaagatgggctttccacaccagtaaaatcaacgccatttcatggaaa
cctgctgaaaagggagcaaacgaagaggaaattgaagaggacttagttgccactggttct
ttagacaccaatatttttatttactccgtcaaaagacctatgaaaatcattaaggcgttg
aatgctcacaaggacggtgttaacaaccttttatgggaaacaccatctaccttggttagt
tctggtgcggacgcttgcattaaaaggtggaatgttgtcctcgagtga

DBGET integrated database retrieval system