KEGG   Saccharomyces cerevisiae (budding yeast): YMR106C
Entry
YMR106C           CDS       T00005                                 

Symbol
YKU80, HDF2
Name
(RefSeq) ATP-dependent DNA helicase YKU80
  KO
K10885  ATP-dependent DNA helicase 2 subunit 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    YMR106C (YKU80)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YMR106C (YKU80)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA-PK complex
     YMR106C (YKU80)
SSDB
Motif
Pfam: Ku_N Ku Ku_C
Other DBs
NCBI-GeneID: 855132
NCBI-ProteinID: NP_013824
SGD: S000004712
UniProt: Q04437
Structure
PDB: 
5Y59 5Y58

Position
XIII:complement(478301..480190)
AA seq 629 aa
MSSESTTFIVDVSPSMMKNNNVSKSMAYLEYTLLNKSKKSRKTDWISCYLANCPVSENSQ
EIPNVFQIQSFLAPVTTTATIGFIKRLKQYCDQHSHDSSNEGLQSMIQCLLVVSLDIKQQ
FQARKILKQIVVFTDNLDDLDITDEEIDLLTEELSTRIILIDCGKDTQEERKKSNWLKLV
EAIPNSRIYNMNELLVEITSPATSVVKPVRVFSGELRLGADILSTQTSNPSGSMQDENCL
CIKVEAFPATKAVSGLNRKTAVEVEDSQKKERYVGVKSIIEYEIHNEGNKKNVSEDDQSG
SSYIPVTISKDSVTKAYRYGADYVVLPSVLVDQTVYESFPGLDLRGFLNREALPRYFLTS
ESSFITADTRLGCQSDLMAFSALVDVMLENRKIAVARYVSKKDSEVNMCALCPVLIEHSN
INSEKKFVKSLTLCRLPFAEDERVTDFPKLLDRTTTSGVPLKKETDGHQIDELMEQFVDS
MDTDELPEIPLGNYYQPIGEVTTDTTLPLPSLNKDQEENKKDPLRIPTVFVYRQQQVLLE
WIHQLMINDSREFEIPELPDSLKNKISPYTHKKFDSTKLVEVLGIKKVDKLKLDSELKTE
LEREKIPDLETLLKRGEQHSRGSPNNSNN
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgtcaagtgagtcaacaactttcatcgtggatgtttcaccatcaatgatgaaaaataat
aatgtttccaaatctatggcatatctagagtacactctattaaacaaatctaaaaaaagt
agaaaaacagattggataagctgttatctcgctaattgtcccgtatctgagaattcccag
gaaataccaaatgtgttccaaatacaatcctttttggctcctgttaccacgacggccacc
attgggtttataaaacgcctgaaacaatattgtgatcagcacagtcatgatagttcgaat
gaaggcttacaatcaatgattcaatgtctgttggtcgtctcattagatattaaacaacaa
tttcaagcaagaaaaattctaaaacaaattgttgtatttacagacaatttagatgatctg
gatattactgatgaagaaatagacctgctaacggaagaattaagcacaagaatcattttg
attgattgcggtaaagacactcaagaggagaggaaaaaatcgaactggttaaagttggtc
gaagcgataccgaattcaagaatctacaatatgaatgaacttcttgttgaaatcacttcc
ccagcaacatctgtcgttaagccagtaagagtattctcaggcgagcttaggttaggggca
gatatattatcaacacaaacatcgaatcctagcggcagcatgcaagatgaaaattgctta
tgtatcaaggtagaggcttttcctgctacgaaagcagtttcaggcttaaataggaaaacc
gctgttgaggtggaagactcccagaagaaagaaaggtatgtgggggtcaaatccataatc
gaatatgaaattcacaacgaaggaaataagaaaaatgtcagtgaagatgaccagtctgga
tcgtcatacattcccgtgaccatctccaaagactctgtaacgaaggcataccgttatggt
gcagactacgtagtgctaccgtccgttctagtcgatcaaactgtatatgaatcttttcca
ggcttggatttaagaggatttttgaatagagaagctcttccaaggtactttttgacgtcg
gaatcctccttcattaccgccgacacaagacttggctgtcaatctgacttaatggctttc
agtgctctagtggatgttatgctagaaaatagaaaaattgctgttgcaagatatgtgagc
aagaaagacagtgaagtgaatatgtgtgcattgtgtcccgttctaattgagcacagtaac
attaattccgagaagaagtttgttaagagccttaccttgtgtagattaccattcgcggaa
gacgagagggtaactgattttccaaaacttctggatcgaacaactacatccggggtaccg
ctgaaaaaggaaacagacgggcatcaaatcgatgagcttatggaacaatttgtagattca
atggatacagatgagctaccagagattccgttaggcaactactatcaacccataggcgaa
gtaacaacagacaccactctcccacttccctctttaaataaagaccaagaggaaaacaaa
aaggatcctcttagaatacccacggtttttgtctacaggcaacaacaggtgctactggaa
tggattcaccaactgatgatcaatgattccagggaatttgaaatcccagagcttcctgac
tcattgaaaaacaaaataagtccttacacgcacaagaaatttgatagcacaaaattggtt
gaagtgctcggcatcaagaaagtagacaaattaaaactcgactccgaactaaaaactgag
cttgagagggaaaagatcccggacctagaaacgctattgaagcgcggtgaacaacacagt
aggggaagtccaaacaatagcaataattaa

DBGET integrated database retrieval system